DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30391 and CG30393

DIOPT Version :9

Sequence 1:NP_611566.2 Gene:CG30391 / 37423 FlyBaseID:FBgn0050391 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_726044.1 Gene:CG30393 / 246588 FlyBaseID:FBgn0050393 Length:354 Species:Drosophila melanogaster


Alignment Length:346 Identity:187/346 - (54%)
Similarity:244/346 - (70%) Gaps:17/346 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEMRDRLYQMMVSQSFMSRGTVTASMANFAIGNLRSSDAVEKRVIKILLVIEEKYRSYFDSYRKE 65
            ||...:|.|:...||.||..|||.|.|.|||.||..::.:|..|.|||:.|||.:.|||:..:||
  Fly     1 METTAQLQQLKPQQSVMSHVTVTESDAEFAILNLDCNEGLESSVTKILVAIEEMFCSYFEDLKKE 65

  Fly    66 LELQRIAAETLHQLIQRYKITMQLDTSCTCPQIYDIESDDAIINKFYIHYQVIASSNKNQCWAIQ 130
            ||||::||.||:||.|||:|..::||||||||||:||||||||||:||:|||||.||.||.|.|.
  Fly    66 LELQKMAALTLNQLTQRYRINTKVDTSCTCPQIYEIESDDAIINKYYIYYQVIACSNNNQGWVIH 130

  Fly   131 SLRPYVLVFRRECAKLNRSEESPFILGDAFHKPIQFFIDLVEELFAYFYSGHLQLDCAARLLDPL 195
            ::|||||:|||||||||.:|:||||:||||||||:|||||||||||||||||:|.||||.:||||
  Fly   131 NMRPYVLLFRRECAKLNLNEDSPFIMGDAFHKPIKFFIDLVEELFAYFYSGHVQFDCAAHMLDPL 195

  Fly   196 DLYRMECYMKLLEPNEDFAEYFLHNISFCKCMRPPPMCPPYEHHQKIKDQSDAYLSHAKKKRCAR 260
            ||..:|.|.||||||||||.||.:|:|||||:|.|..||.:|:.|..:|.:..:::.||||||||
  Fly   196 DLNSIEYYQKLLEPNEDFANYFKYNMSFCKCLRMPRRCPAHEYPQVKEDFNATFVNQAKKKRCAR 260

  Fly   261 RFERMAQNEAQTAKRESGSV--ERKMSIGSARTTRSLSREASVVEEAVSVSNQQHERTLRDQLMC 323
            |.|:||:.|:....|:...|  :|...:....|.:.|.::.....:.:|...::.||::      
  Fly   261 RCEKMAEAESNLLDRKKSIVRLQRPSEMSGISTGQELDQDNERELKRISRHQRRSERSI------ 319

  Fly   324 ALSIS--------PEKRHDAT 336
             :||:        |:.||:.|
  Fly   320 -ISITKEDYHTPLPDNRHELT 339



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471563
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2FB6M
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0014254
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.