DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ASPP and MYO16

DIOPT Version :9

Sequence 1:NP_788423.1 Gene:ASPP / 37422 FlyBaseID:FBgn0034606 Length:1069 Species:Drosophila melanogaster
Sequence 2:NP_001185879.1 Gene:MYO16 / 23026 HGNCID:29822 Length:1880 Species:Homo sapiens


Alignment Length:185 Identity:52/185 - (28%)
Similarity:81/185 - (43%) Gaps:34/185 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   832 TSATSTTTTVTTSNIKERTGNGKPKLGRRVSFDPLALLLDASLEGELELVKKTAMQVANPSAAND 896
            |.::|...|....|..:.|...:.||.|     |:::|.|         ||.......|.:..||
Human   192 TESSSILLTYLDENGVDLTSLRQMKLQR-----PMSMLTD---------VKHFLSSGGNVNEKND 242

  Fly   897 EGITALHNAICAGHIDIVKFLVEFGCDVNAQDSDGWTPLHCAASCNNLSMVKFLVESGACLFAST 961
            ||:|.||.|..:|:.::|..::|.|.|:|..|...|||||.||.....::||.|:...|      
Human   243 EGVTLLHMACASGYKEVVSLILEHGGDLNIVDDQYWTPLHLAAKYGQTNLVKLLLMHQA------ 301

  Fly   962 LSDHETPAEKCEEDEEGFDGCSEYLYSIQEKLGILHNGDVYAVFSYEAQNGDELS 1016
             :.|   ...|.|::......||:   |:|.|       :.|..::|.:..:.||
Human   302 -NPH---LVNCNEEKASDIAASEF---IEEML-------LKAEIAWEEKMKEPLS 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ASPPNP_788423.1 ANK 867..968 CDD:238125 32/100 (32%)
Ank_2 869..955 CDD:289560 30/85 (35%)
ANK repeat 869..895 CDD:293786 5/25 (20%)
ANK repeat 897..928 CDD:293786 12/30 (40%)
ANK repeat 930..955 CDD:293786 10/24 (42%)
SH3_ASPP 999..1056 CDD:212741 4/18 (22%)
MYO16NP_001185879.1 ANKYR 81..332 CDD:223738 49/173 (28%)
ANK repeat 86..112 CDD:293786
ANK 89..190 CDD:238125
ANK repeat 114..145 CDD:293786
ANK 142..297 CDD:238125 38/118 (32%)
ANK repeat 147..178 CDD:293786
ANK repeat 180..210 CDD:293786 4/17 (24%)
ANK repeat 243..274 CDD:293786 12/30 (40%)
ANK repeat 276..307 CDD:293786 12/40 (30%)
ANK repeat 309..335 CDD:293786 7/35 (20%)
MYSc 426..1165 CDD:214580
MYSc_Myo16 437..1155 CDD:276844
NYAP_N 1253..1590 CDD:292079
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0515
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.