DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt49C1 and UGT85A7

DIOPT Version :9

Sequence 1:NP_001036565.1 Gene:Ugt49C1 / 37421 FlyBaseID:FBgn0034605 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_173652.1 Gene:UGT85A7 / 838841 AraportID:AT1G22340 Length:487 Species:Arabidopsis thaliana


Alignment Length:410 Identity:81/410 - (19%)
Similarity:157/410 - (38%) Gaps:113/410 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 PKVRSLIHAEQKEGV--FDLLLAEQFYQEAFLALAHLYKIPVV---TTSTLGYENHMSQMMGLIT 186
            |.|..::    .:||  |.|..||:.            .:|.|   |.|..|:       |.::.
plant   118 PPVSCIV----SDGVMSFTLDAAEEL------------GVPEVIFWTNSACGF-------MTILH 159

  Fly   187 PWSFVPHGFMPFTDRMSFLERVKNSYASFYEDMDRLLNYFPKMDAVAREFFGPVLTEVPK----- 246
            .:.|:..|..||.|         .||.| .|.:|.::::.|.|..:.       |.::|.     
plant   160 FYLFIEKGLSPFKD---------ESYMS-KEHLDTVIDWIPSMKNLR-------LKDIPSYIRTT 207

  Fly   247 ----------VKHMER--QISVMLLNS-----HAPLTTARPTVDAMVPVGGMHIYPPKPL----- 289
                      ::.:||  :.|.::||:     |..:.:.:..:..:..:|.:|:...:.:     
plant   208 NPDNIMLNFLIREVERSKRASAIILNTFDELEHDVIQSMQSILPPVYSIGPLHLLVKEEINEASE 272

  Fly   290 ---------PADMQAL--LDGATEGAIFF-SLGSNVQSKDMPVEMLRLFLQVFGSLKQRVLWKFE 342
                     ..:|:.|  ||..|..::.| :.|....   |..:.|..|.....:.::..||...
plant   273 IGQMGLNLWREEMECLDWLDTKTPNSVLFVNFGCITV---MSAKQLEEFAWGLAASRKEFLWVIR 334

  Fly   343 -------------DESISQLPDNVMVRKWLPQADILAHRHVKVFITHGGLFGTQEGVHYAVPMLG 394
                         .|.:::..|..|:..|.||..:|:|..:..|:||.|...|.|.:...|||:.
plant   335 PNLVVGEAMVVLPQEFLAETIDRRMLASWCPQEKVLSHPAIGGFLTHCGWNSTLESLAGGVPMIC 399

  Fly   395 IPFYCDQHLNMNKAVLGGYAISLHFQSITEEILRHSLDQLIHNVTYKENVQRVSDIFRDRPLEPR 459
            .|.:.:|..|. |.....:.:.:   .|.:::.|..::.::..:...|..:::    |::..|.|
plant   400 WPCFSEQPTNC-KFCCDEWGVGI---EIGKDVKREEVETVVRELMDGEKGKKL----REKAEEWR 456

  Fly   460 KSAVYWIEYVIRHR-GASHM 478
            :.|    |...|:: |:|.|
plant   457 RLA----EEATRYKHGSSVM 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt49C1NP_001036565.1 egt 22..504 CDD:223071 81/410 (20%)
UDPGT 37..498 CDD:278624 81/410 (20%)
UGT85A7NP_173652.1 Glycosyltransferase_GTB-type 12..481 CDD:385653 81/410 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.