DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt49C1 and AT1G06000

DIOPT Version :9

Sequence 1:NP_001036565.1 Gene:Ugt49C1 / 37421 FlyBaseID:FBgn0034605 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_563756.1 Gene:AT1G06000 / 837109 AraportID:AT1G06000 Length:435 Species:Arabidopsis thaliana


Alignment Length:425 Identity:85/425 - (20%)
Similarity:139/425 - (32%) Gaps:127/425 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 VYAFPGKSHFMMHTALIRELVESGHQVTMVTAFSLEKEQLGSNYTEILIEPVYDFWHDVKLNFGA 94
            |..||...|.:.|..|..:::..|..||                  :|:.|              
plant    13 VIPFPQSGHMVPHLDLTHQILLRGATVT------------------VLVTP-------------- 45

  Fly    95 QHLFELTRMTNYDFLKMLEIIGLKTTEH-------------------ALRQPKVRSLIHAEQKEG 140
                     .|..:|..|.  .|.:.||                   :|:|..:.:::|      
plant    46 ---------KNSSYLDALR--SLHSPEHFKTLILPFPSHPCIPSGVESLQQLPLEAIVH------ 93

  Fly   141 VFDLLLAEQFYQEAFLALAHLYKIPVVTTSTLGYENHMSQMMG--LITPW-SFVPHGFMPFTDRM 202
            :||             ||:.|:...|...|.....:....::|  .::|| :.|...|.  ...:
plant    94 MFD-------------ALSRLHDPLVDFLSRQPPSDLPDAILGSSFLSPWINKVADAFS--IKSI 143

  Fly   203 SFLERVKNSYASFYEDMDRLLNYFPKMDAVAREFFGPVLTEVPKVK-HMERQISVMLLNSH---- 262
            |||....:|.:..:...||  ::|..::....|.:|.|:.....:: .....:....||.|    
plant   144 SFLPINAHSISVMWAQEDR--SFFNDLETATTESYGLVINSFYDLEPEFVETVKTRFLNHHRIWT 206

  Fly   263 -APLTTARPTVDAMVPVGGMHIYPPKPLPADMQALLDGATE--GAIFFSLGSNVQSKDMPVEMLR 324
             .||...:..||.    ||....|    ||.:.|.||...|  ..::...||.::   :..|...
plant   207 VGPLLPFKAGVDR----GGQSSIP----PAKVSAWLDSCPEDNSVVYVGFGSQIR---LTAEQTA 260

  Fly   325 LFLQVFGSLKQRVLWKFED------ESISQLPDNV--------------MVRKWLPQADILAHRH 369
            ...........|.:|...|      .|.:.:.::|              ::|.|.||..||.||.
plant   261 ALAAALEKSSVRFIWAVRDAAKKVNSSDNSVEEDVIPAGFEERVKEKGLVIRGWAPQTMILEHRA 325

  Fly   370 VKVFITHGGLFGTQEGVHYAVPMLGIPFYCDQHLN 404
            |..::||.|.....||:...|.:|..|...|...|
plant   326 VGSYLTHLGWGSVLEGMVGGVMLLAWPMQADHFFN 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt49C1NP_001036565.1 egt 22..504 CDD:223071 85/425 (20%)
UDPGT 37..498 CDD:278624 82/418 (20%)
AT1G06000NP_563756.1 Glycosyltransferase_GTB-type 8..430 CDD:385653 85/425 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.