DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt49C1 and UGT74E2

DIOPT Version :9

Sequence 1:NP_001036565.1 Gene:Ugt49C1 / 37421 FlyBaseID:FBgn0034605 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_172059.1 Gene:UGT74E2 / 837075 AraportID:AT1G05680 Length:453 Species:Arabidopsis thaliana


Alignment Length:519 Identity:112/519 - (21%)
Similarity:193/519 - (37%) Gaps:122/519 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LAEGSKILAVYAFPGKSHFMMHTALIRELVESGHQVTMVTAFSLEKEQLGSNYTEILIEPVYDFW 85
            :.|||.:: |..|||:.|....:...:.|...|.::|:|...........:.:..|.:.|:.:.:
plant     1 MREGSHLI-VLPFPGQGHITPMSQFCKRLASKGLKLTLVLVSDKPSPPYKTEHDSITVFPISNGF 64

  Fly    86 HDVKLNFGAQHLFELTRMTNYDFLKMLEIIGLKTTEHALRQPKV-----RSLIHAEQKEGVFDL- 144
            .:     |.:.|.:|.     |:::.:|.....|....:...|:     |::::......:.|: 
plant    65 QE-----GEEPLQDLD-----DYMERVETSIKNTLPKLVEDMKLSGNPPRAIVYDSTMPWLLDVA 119

  Fly   145 ----LLAEQFYQEAFLALA---HLYKIPVVTTSTLGYENHMSQMMGLITPWSFVPHGFMPFTDRM 202
                |....|:.:.:|..|   |::|         |..:..|...|..|..||.....:...|..
plant   120 HSYGLSGAVFFTQPWLVTAIYYHVFK---------GSFSVPSTKYGHSTLASFPSFPMLTANDLP 175

  Fly   203 SFLERVKNSYASFYEDMDRLLNYFPKMDAVAREFFGPVLTEVPKVKHMERQISVMLLNSHAPLTT 267
            |||.. .:||.:....:...|:...::|.|....|..:..::.|           .:.|..|:..
plant   176 SFLCE-SSSYPNILRIVVDQLSNIDRVDIVLCNTFDKLEEKLLK-----------WVQSLWPVLN 228

  Fly   268 ARPTVDAMVPVGGMHIYPPKPLPAD---------------MQALLDGATEGAIFFSLGSNVQSKD 317
            ..|||.:|        |..|.|..|               |:.|........::.|.||.|..|:
plant   229 IGPTVPSM--------YLDKRLSEDKNYGFSLFNAKVAECMEWLNSKEPNSVVYLSFGSLVILKE 285

  Fly   318 MPVEMLRLFLQVFGSLKQR---VLWKFEDESISQLPDNV--------MVRKWLPQADILAHRHVK 371
            ..:      |::...|||.   .||...:....:||.|.        ::..|.||.|:|||:.:.
plant   286 DQM------LELAAGLKQSGRFFLWVVRETETHKLPRNYVEEIGEKGLIVSWSPQLDVLAHKSIG 344

  Fly   372 VFITHGGLFGTQEGVHYAVPMLGIPFYCDQHLNMN------------KAVLGGYAISLHFQSITE 424
            .|:||.|...|.||:...|||:|:|.:.||..|..            ||...|:.       ..|
plant   345 CFLTHCGWNSTLEGLSLGVPMIGMPHWTDQPTNAKFMQDVWKVGVRVKAEGDGFV-------RRE 402

  Fly   425 EILRHSLDQLIHNVTYKENVQRVSDIFRDRPLEPRKSAVYWIEYVIRHRGASHMRSAGLDLNWF 488
            ||:| |:::::..               ::..|.||:|..|  .|:.....|...|:...:|.|
plant   403 EIMR-SVEEVMEG---------------EKGKEIRKNAEKW--KVLAQEAVSEGGSSDKSINEF 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt49C1NP_001036565.1 egt 22..504 CDD:223071 112/518 (22%)
UDPGT 37..498 CDD:278624 105/503 (21%)
UGT74E2NP_172059.1 Glycosyltransferase_GTB-type 6..450 CDD:415824 109/514 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.