DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt49C1 and AT5G38040

DIOPT Version :9

Sequence 1:NP_001036565.1 Gene:Ugt49C1 / 37421 FlyBaseID:FBgn0034605 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_198620.1 Gene:AT5G38040 / 833784 AraportID:AT5G38040 Length:449 Species:Arabidopsis thaliana


Alignment Length:421 Identity:86/421 - (20%)
Similarity:154/421 - (36%) Gaps:109/421 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 PGKSHFMMHTALIRELVESGHQVTMV-TAFS-LEKEQLGSNYTEILIE---PVYDFWHDVKLNFG 93
            |.:.|......|.:.|...|..:|:| |.|: |......|::..:.|.   ||.|.     .|.|
plant    17 PAQGHITPMIQLAKALHSKGFSITVVQTKFNYLNPSNDLSDFQFVTIPENLPVSDL-----KNLG 76

  Fly    94 AQHLFELTRMTNYDFLKMLEIIGLKTTEHALRQPKVRSLIHAEQKEG--VFDLLLAEQFYQEAFL 156
            ....  |.::.|..::...:::|             :.|::.|::..  ::|..:   ::.|..:
plant    77 PGRF--LIKLANECYVSFKDLLG-------------QLLVNEEEEIACVIYDEFM---YFVEVAV 123

  Fly   157 ALAHLYKIPVVTTSTLGYENHMSQMMGLITPWSFVPHGFMPFTDRMSFLE-RVKNSYASFYEDMD 220
            ....|..:.:.|||...                        |..|....| ..|:..|...|..:
plant   124 KEFKLRNVILSTTSATA------------------------FVCRFVMCELYAKDGLAQLKEGGE 164

  Fly   221 RLLNYFPKMDAVAREFFGPVLTEVPKVKHMERQISVMLLNSHAPLTTARPTV------------- 272
            |.:...|::..:..:       ::|.......:.||.|..:.....||...:             
plant   165 REVELVPELYPIRYK-------DLPSSVFASVESSVELFKNTCYKGTASSVIINTVRCLEMSSLE 222

  Fly   273 ----DAMVPV---GGMHIY---PPKPLPADMQALLDGATE----GAIFFSLGS--NVQSKDMPVE 321
                :..:||   |.:|:.   ||..|..:.::.::...:    ..|:.||||  .:::|:| :|
plant   223 WLQQELEIPVYSIGPLHMVVSAPPTSLLEENESCIEWLNKQKPSSVIYISLGSFTLMETKEM-LE 286

  Fly   322 MLRLFLQVFGSLKQRVLWKFEDESI--SQLPDNVMVR-----------KWLPQADILAHRHVKVF 373
            |...|:    |..|..||.....||  |::.:..:::           ||.||..:|||..|..|
plant   287 MAYGFV----SSNQHFLWVIRPGSICGSEISEEELLKKMVITDRGYIVKWAPQKQVLAHSAVGAF 347

  Fly   374 ITHGGLFGTQEGVHYAVPMLGIPFYCDQHLN 404
            .:|.|...|.|.:...||::..||..||..|
plant   348 WSHCGWNSTLESLGEGVPLICRPFTTDQKGN 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt49C1NP_001036565.1 egt 22..504 CDD:223071 86/421 (20%)
UDPGT 37..498 CDD:278624 85/418 (20%)
AT5G38040NP_198620.1 Glycosyltransferase_GTB-type 1..446 CDD:415824 86/421 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.