DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt49C1 and AT5G37950

DIOPT Version :9

Sequence 1:NP_001036565.1 Gene:Ugt49C1 / 37421 FlyBaseID:FBgn0034605 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_198611.1 Gene:AT5G37950 / 833774 AraportID:AT5G37950 Length:351 Species:Arabidopsis thaliana


Alignment Length:297 Identity:68/297 - (22%)
Similarity:117/297 - (39%) Gaps:66/297 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 EQKEGVFDLLLAE-QFYQEAFLALAHLYKIPVVTTSTLGYENH-----MSQMMGLITPWSFVPHG 194
            :|:|.:..::..| .::.|   |.|..:.:|.|..||   ||.     .|.|..|     :...|
plant    78 QQQEEIACVIYDEFMYFAE---AAAKEFNLPKVIFST---ENATAFACRSAMCKL-----YAKDG 131

  Fly   195 FMPFTDRMSFLER-VKNSYASFYEDMDRLLNYFPKMDAVAREFFGPV--LTEVPKVKHMERQISV 256
            ..|.|:.....|. |...:...|:|:             ....|.||  ..||.|....:...|.
plant   132 IAPLTEGCGREEELVPELHPLRYKDL-------------PTSAFAPVEASVEVFKSSCEKGTASS 183

  Fly   257 MLLNSHAPLTTA------RPTVDAMVPVGGMHIY---PPKPLPADMQALLDGATE----GAIFFS 308
            |::|:.:.|..:      :.....:.|:|.:::.   ||..|..:.::.:|...:    ..|:.|
plant   184 MIINTVSCLEISSLEWLQQELKIPIYPIGPLYMVSSAPPTSLLDENESCIDWLNKQKPSSVIYIS 248

  Fly   309 LGS--NVQSKDMPVEMLRLFLQVFGSLKQRVLWKFEDESI-------------SQLPDNVMVRKW 358
            |||  .:::|:: :||....:    |..|..||.....||             .::||...:.||
plant   249 LGSFTLLETKEV-LEMASGLV----SSNQYFLWAIRPGSILGSELSNEELFSMMEIPDRGYIVKW 308

  Fly   359 LPQADILAHRHVKVFITHGGLFGTQEGVHYAVPMLGI 395
            ..|..:|||..|..|.:|.|...|.|.:...:|::|:
plant   309 ATQKQVLAHAAVGAFWSHCGWNSTLESIGEGIPIVGL 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt49C1NP_001036565.1 egt 22..504 CDD:223071 68/297 (23%)
UDPGT 37..498 CDD:278624 68/297 (23%)
AT5G37950NP_198611.1 Glycosyltransferase_GTB_type 1..343 CDD:299143 67/293 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.