DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt49C1 and AT5G03490

DIOPT Version :9

Sequence 1:NP_001036565.1 Gene:Ugt49C1 / 37421 FlyBaseID:FBgn0034605 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_195969.1 Gene:AT5G03490 / 831823 AraportID:AT5G03490 Length:465 Species:Arabidopsis thaliana


Alignment Length:439 Identity:91/439 - (20%)
Similarity:164/439 - (37%) Gaps:99/439 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLLTGTLYSQLELAEGSK--ILAVYAFPGKSHFMMHTALIRELVESGHQVT-MVTAFSLE-KEQL 69
            |||.||      .:|.||  .:.|:.||.:.|.:....|..:|...|..|: :||..:|. ...|
plant     5 LLLPGT------KSENSKPPHIVVFPFPAQGHLLPLLDLTHQLCLRGFNVSVIVTPGNLTYLSPL 63

  Fly    70 GSNYTEILIEPVYDFWHDVKLNFGAQHLFELTRMTNYDFLKMLEIIGLKTTEHALRQPKVRSLIH 134
            .|.:...:...|:.|.....|:.|.:::.::....|...:..|         ..||:|    :|:
plant    64 LSAHPSSVTSVVFPFPPHPSLSPGVENVKDVGNSGNLPIMASL---------RQLREP----IIN 115

  Fly   135 AEQKEGVFDLLLAEQFYQEAFLALAHLYKIPVVTTSTLGYENHMSQMMGLITPWSFVPHGFMPFT 199
            ..|......:.|...|:                    ||:.:.:...:| |..::|....|. ..
plant   116 WFQSHPNPPIALISDFF--------------------LGWTHDLCNQIG-IPRFAFFSISFF-LV 158

  Fly   200 DRMSF----LERVKNSYASFYEDMDRLLNYFPKMDAVAREFFGPVL-----TEVPKVKHMERQIS 255
            ..:.|    ::.:|::      |...||: .|:......|....::     |..|.::.: :..|
plant   159 SVLQFCFENIDLIKST------DPIHLLD-LPRAPIFKEEHLPSIVRRSLQTPSPDLESI-KDFS 215

  Fly   256 VMLLNSHAPLTTARPTVDAMVP-----VGGMHIYPPKPL--------------PADMQALLDGAT 301
            :.||:..:...::....|..:.     :|...:|...||              ...:.:.|||:.
plant   216 MNLLSYGSVFNSSEILEDDYLQYVKQRMGHDRVYVIGPLCSIGSGLKSNSGSVDPSLLSWLDGSP 280

  Fly   302 EGAIFF-SLGS-NVQSKDMPVEMLRLFLQVFGSLKQRVLWKFEDESISQLPD---------NVMV 355
            .|::.: ..|| ...:||. .:.|.|.|:   ....|.:|..:.:.|   ||         .::|
plant   281 NGSVLYVCFGSQKALTKDQ-CDALALGLE---KSMTRFVWVVKKDPI---PDGFEDRVSGRGLVV 338

  Fly   356 RKWLPQADILAHRHVKVFITHGGLFGTQEGVHYAVPMLGIPFYCDQHLN 404
            |.|:.|..:|.|..|..|::|.|.....||:.....:||.|...||.:|
plant   339 RGWVSQLAVLRHVAVGGFLSHCGWNSVLEGITSGAVILGWPMEADQFVN 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt49C1NP_001036565.1 egt 22..504 CDD:223071 86/426 (20%)
UDPGT 37..498 CDD:278624 80/409 (20%)
AT5G03490NP_195969.1 Glycosyltransferase_GTB_type 19..460 CDD:299143 83/419 (20%)
YjiC 19..447 CDD:224732 83/419 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.