DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt49C1 and AT5G05880

DIOPT Version :9

Sequence 1:NP_001036565.1 Gene:Ugt49C1 / 37421 FlyBaseID:FBgn0034605 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_196207.1 Gene:AT5G05880 / 830473 AraportID:AT5G05880 Length:451 Species:Arabidopsis thaliana


Alignment Length:497 Identity:103/497 - (20%)
Similarity:190/497 - (38%) Gaps:133/497 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LLFGLLLTGTLYSQLELAEGSKILAVYAFPGKSHFMMHTALIRELVESGHQVTMV-TAFSLEKEQ 68
            :||.|.|.|.:...::||:                ::|:        .|..:|:: |.|:..|  
plant    10 ILFPLPLQGCINPMIQLAK----------------ILHS--------RGFSITVIHTCFNAPK-- 48

  Fly    69 LGSNYTEILIEPVYDFWHDVKLNFGAQHLFELTRMTNYDFLKMLEIIGLKTTEHALRQPKVRSLI 133
             .|::      |::.|   :::..|.......||     .:|:|..:..:..|..:|: .:|.|:
plant    49 -ASSH------PLFTF---IQIQDGLSETETRTR-----DVKLLITLLNQNCESPVRE-CLRKLL 97

  Fly   134 HA--EQKEGVFDLLLAEQFYQEAFLALAHLYKIPVVTTSTLGYENHMSQMMGLITPWSFVPHGFM 196
            .:  |:|:.:..|:     ....::...||.|  .:....|.:..:....        |..|..:
plant    98 QSAKEEKQRISCLI-----NDSGWIFTQHLAK--SLNLMRLAFNTYKISF--------FRSHFVL 147

  Fly   197 PFTDRMSFLERVKNSYASFYEDMDRLLNYFPKM-----------DAVAREFFGPVLTEVPKVKHM 250
            |...|..||. :::|      :.|..:..||.:           |:|..:.:..::.|..|..  
plant   148 PQLRREMFLP-LQDS------EQDDPVEKFPPLRKKDLLRILEADSVQGDSYSDMILEKTKAS-- 203

  Fly   251 ERQISVMLLNSHAPL---TTARPTVDAMVP---VGGMHIYPPKPLPADMQAL----------LDG 299
                |.::..|...|   :.::...|..||   :|..|.:    .||...:|          ||.
plant   204 ----SGLIFMSCEELDQDSLSQSREDFKVPIFAIGPSHSH----FPASSSSLFTPDETCIPWLDR 260

  Fly   300 ATE-GAIFFSLGSNVQSKDMPVEMLRLFLQVFGSLKQRVLWKFE------DESISQLPDNVMVR- 356
            ..: ..|:.|:||.|...:  .|::.:...:..| .|..||...      .|.|..:|:..:.| 
plant   261 QEDKSVIYVSIGSLVTINE--TELMEIAWGLSNS-DQPFLWVVRVGSVNGTEWIEAIPEYFIKRL 322

  Fly   357 -------KWLPQADILAHRHVKVFITHGGLFGTQEGVHYAVPMLGIPFYCDQHLNMNKAVLGGYA 414
                   ||.||.::|.||.:..|:||.|...|.|.|...|||:.:||..||.||. :.|...:.
plant   323 NEKGKIVKWAPQQEVLKHRAIGGFLTHNGWNSTVESVCEGVPMICLPFRWDQLLNA-RFVSDVWM 386

  Fly   415 ISLHFQSITEEILRHSLDQLIHNV-------TYKENVQRVSD 449
            :.:|.:.   .|.|..:::.|..:       ..:|.:|.:.:
plant   387 VGIHLEG---RIERDEIERAIRRLLLETEGEAIRERIQLLKE 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt49C1NP_001036565.1 egt 22..504 CDD:223071 97/480 (20%)
UDPGT 37..498 CDD:278624 96/465 (21%)
AT5G05880NP_196207.1 Glycosyltransferase_GTB-type 2..451 CDD:385653 103/497 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.