DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt49C1 and AT4G36770

DIOPT Version :9

Sequence 1:NP_001036565.1 Gene:Ugt49C1 / 37421 FlyBaseID:FBgn0034605 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_195395.4 Gene:AT4G36770 / 829830 AraportID:AT4G36770 Length:457 Species:Arabidopsis thaliana


Alignment Length:499 Identity:113/499 - (22%)
Similarity:177/499 - (35%) Gaps:136/499 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 AVYAFPGKSHFMMHTALIRELVESGHQVTMVTAF------SLEKEQLGSNYTEILIEPVYDFWHD 87
            |:.|.||..|.:....|.:.|: :.|....||.|      |..|..:|....|...:.|..|   
plant     6 ALVASPGMGHAVPILELGKHLL-NHHGFDRVTVFLVTDDVSRSKSLIGKTLMEEDPKFVIRF--- 66

  Fly    88 VKLNFGAQHLFELTRMTNYDFLKMLEIIGLKTTEHALRQPKVR-SLIHAEQKEGVF--DLLLAEQ 149
            :.|:...|.|      :.....|:.|::     ..||  |::: |::..|.:..||  |||..|.
plant    67 IPLDVSGQDL------SGSLLTKLAEMM-----RKAL--PEIKSSVMELEPRPRVFVVDLLGTEA 118

  Fly   150 FYQEAFLALAHLYKIPVVTTSTLGYENHMSQMMGLITPWSFVPHGFMPFTDRMSFLERVKNSYAS 214
            .  |....|..:.|..:||||.                |      |:.||..|:.|         
plant   119 L--EVAKELGIMRKHVLVTTSA----------------W------FLAFTVYMASL--------- 150

  Fly   215 FYEDMDRLLNYFPKMDAVAREFFGPVLTE--------VPKVKHMERQISVMLLNSHAPLTTARPT 271
               |...|......:.|:......||..|        :.::...:| |...::.:.........:
plant   151 ---DKQELYKQLSSIGALLIPGCSPVKFERAQDPRKYIRELAESQR-IGDEVITADGVFVNTWHS 211

  Fly   272 VDAMVPVG-------------GMHIYPPKPL--PAD---MQALLD----GATEGAIFFSLGSNVQ 314
            :: .|.:|             |:.:||..||  ||:   ...:||    ...|..::.|.||...
plant   212 LE-QVTIGSFLDPENLGRVMRGVPVYPVGPLVRPAEPGLKHGVLDWLDLQPKESVVYVSFGSGGA 275

  Fly   315 SKDMPVEMLRLFLQVFGSLKQRVLW------------------KFEDESISQLPD---------N 352
            ........|...|::.|   .|.:|                  |.|.|.:..||:         .
plant   276 LTFEQTNELAYGLELTG---HRFVWVVRPPAEDDPSASMFDKTKNETEPLDFLPNGFLDRTKDIG 337

  Fly   353 VMVRKWLPQADILAHRHVKVFITHGGLFGTQEGVHYAVPMLGIPFYCDQHLNMNKAVLGGYAISL 417
            ::||.|.||.:||||:....|:||.|.....|.:...|||:..|.|.:|.:|. :.|.|...|:|
plant   338 LVVRTWAPQEEILAHKSTGGFVTHCGWNSVLESIVNGVPMVAWPLYSEQKMNA-RMVSGELKIAL 401

  Fly   418 HFQSITEEILRHSLDQLIHNVTYKENVQRVSDIFRDRPLEPRKS 461
            ..         :..|.::......|.|:||.|  .:...|.||:
plant   402 QI---------NVADGIVKKEVIAEMVKRVMD--EEEGKEMRKN 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt49C1NP_001036565.1 egt 22..504 CDD:223071 113/499 (23%)
UDPGT 37..498 CDD:278624 109/491 (22%)
AT4G36770NP_195395.4 Glycosyltransferase_GTB_type 4..448 CDD:299143 113/499 (23%)
YjiC 6..451 CDD:224732 113/499 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.