DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt49C1 and AT4G15260

DIOPT Version :9

Sequence 1:NP_001036565.1 Gene:Ugt49C1 / 37421 FlyBaseID:FBgn0034605 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_193261.2 Gene:AT4G15260 / 827192 AraportID:AT4G15260 Length:359 Species:Arabidopsis thaliana


Alignment Length:388 Identity:81/388 - (20%)
Similarity:129/388 - (33%) Gaps:128/388 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   195 FMPFTDRMSFLE---RVKNSYASFYEDMDRLLNYFPKMDAVAREFFGPVLTEVPKVKHME----- 251
            :|.:|...:||.   .|:..|.....|:..|       |....|...|.||....||.:.     
plant    18 YMIYTSNATFLGITLHVQEMYDDKKYDVSDL-------DESVNELEFPCLTRPYPVKCLPHILSS 75

  Fly   252 --------------RQISVMLLNSHAPLTTARP-------TVDAMVPVGGMHIYPPKP-LPAD-- 292
                          |::..:|:|:.|.|   .|       .||  :|    ..||..| |..|  
plant    76 KDWLPFFAAQGRSFRKMKGILVNTVAEL---EPHALKMFNNVD--LP----QAYPVGPVLHLDNG 131

  Fly   293 ----------MQALLDGATEGAIFFSLGS-----NVQSKDMPVEMLRLFLQVFGSLKQRVLWKFE 342
                      ::.|.|...:..:|...||     ..|::::.|.:.|        ...|.||...
plant   132 DDDDEKRLEVLRWLDDQPPKSVLFLCFGSMGGFTEEQTREVAVALNR--------SGHRFLWSLR 188

  Fly   343 DESIS--------------QLPDNVMVRK--------WLPQADILAHRHVKVFITHGGLFGTQEG 385
            ..|.:              .|||..:.|.        |.||..:|....:..|:||.|.....|.
plant   189 RASPNIMMERPGDYKNLEEVLPDGFLERTLDRGKVIGWAPQVAVLEKPAIGGFVTHCGWNSMLES 253

  Fly   386 VHYAVPMLGIPFYCDQHLN-------------MNKAVLGGYAISLHFQSITEEILRHSLDQLIHN 437
            :.:.|||:..|.|.:|.:|             :.|.:.|...:....:.:|.|    .:::.|..
plant   254 LWFGVPMVTWPLYAEQKVNAFEMVEELGLAVEIRKCISGDLLLIGEMEIVTAE----DIERAIRC 314

  Fly   438 VTYKENVQRVSDIFRDRPLEPRKSAVYWIEYVIRHRGASHMRSAGLDLNWFQFYLLDVIAFVA 500
            |     :::.||: |.|..|..:..     :|....|.|...:       .|.::.|||..||
plant   315 V-----MEQDSDV-RSRVKEMAEKC-----HVALMDGGSSKTA-------LQKFIQDVIENVA 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt49C1NP_001036565.1 egt 22..504 CDD:223071 81/388 (21%)
UDPGT 37..498 CDD:278624 79/384 (21%)
AT4G15260NP_193261.2 Glycosyltransferase_GTB_type <1..359 CDD:299143 79/386 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.