DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt49C1 and AT3G55710

DIOPT Version :9

Sequence 1:NP_001036565.1 Gene:Ugt49C1 / 37421 FlyBaseID:FBgn0034605 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_191130.1 Gene:AT3G55710 / 824737 AraportID:AT3G55710 Length:464 Species:Arabidopsis thaliana


Alignment Length:247 Identity:56/247 - (22%)
Similarity:93/247 - (37%) Gaps:61/247 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   211 SYASFYEDMDRLLNYFP----KMDAVAREFFGPVLTEVPKVKHMERQISVMLLNS---------- 261
            :|.:|...:|:  .|.|    ::|.:..|.....:.::|.:|..|.:....:||.          
plant   145 AYTAFPLLIDK--GYLPIQGSRLDELVTELPPLKVKDLPVIKTKEPEGLNRILNDMVEGAKLSSG 207

  Fly   262 -----------HAPLTTARPTVDAMVPVGGMHIY----PPKPLPADM---QALLD----GATEGA 304
                       |:.:.........:.|:|..|.:    ||||...|.   :.|.|    .|.:..
plant   208 VVWNTFEDLERHSLMDCRSKLQVPLFPIGPFHKHRTDLPPKPKNKDKDDDEILTDWLNKQAPQSV 272

  Fly   305 IFFSLGSNVQSKDMPVEMLRLFLQVFGSLKQR---VLWKFE------DESISQLP----DNV--- 353
            ::.|.||....::      ..|.::...|:..   .||...      .|.:..||    :|:   
plant   273 VYVSFGSLAAIEE------NEFFEIAWGLRNSELPFLWVVRPGMVRGTEWLESLPCGFLENIGHQ 331

  Fly   354 -MVRKWLPQADILAHRHVKVFITHGGLFGTQEGVHYAVPMLGIPFYCDQHLN 404
             .:.||:.|.:.|||..|..|.||.|...|.|.:...|||:..|.:.|||:|
plant   332 GKIVKWVNQLETLAHPAVGAFWTHCGWNSTIESICEGVPMICTPCFSDQHVN 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt49C1NP_001036565.1 egt 22..504 CDD:223071 56/247 (23%)
UDPGT 37..498 CDD:278624 56/247 (23%)
AT3G55710NP_191130.1 Glycosyltransferase_GTB_type 1..454 CDD:299143 56/247 (23%)
YjiC 7..421 CDD:224732 56/247 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.