DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt49C1 and AT3G46700

DIOPT Version :9

Sequence 1:NP_001036565.1 Gene:Ugt49C1 / 37421 FlyBaseID:FBgn0034605 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_190254.2 Gene:AT3G46700 / 823823 AraportID:AT3G46700 Length:447 Species:Arabidopsis thaliana


Alignment Length:284 Identity:63/284 - (22%)
Similarity:108/284 - (38%) Gaps:92/284 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   251 ERQISVMLLNSHAPLTTA---RPTVDAMVPVGGMHIYPPKPLPADMQALLDGAT----------- 301
            :|..|.:::|:...|.::   |...:..:||     ||..||     .:.|.:|           
plant   196 KRTASAVIINTVTCLESSSLTRLQQELQIPV-----YPLGPL-----HITDSSTGFTVLQEDRSC 250

  Fly   302 ---------EGAIFFSLGSNV--QSKDMPVEMLRLFLQVFGSL--KQRVLWKFE------DESIS 347
                     ...|:.||||.|  ::|:| :||      .:|.|  .|..||...      .|.|.
plant   251 VEWLNKQKPRSVIYISLGSMVLMETKEM-LEM------AWGMLNSNQPFLWVIRPGSVSGSEGIE 308

  Fly   348 QLPDNV--------MVRKWLPQADILAHRHVKVFITHGGLFGTQEGVHYAVPMLGIPFYCDQHLN 404
            .||:.|        .:.||.||.::|.|..|..|.:|.|...|.|.:...|||:..|:..:|.||
plant   309 SLPEEVSKMVLEKGYIVKWAPQIEVLGHPSVGGFWSHCGWNSTLESIVEGVPMICRPYQGEQMLN 373

  Fly   405 MNKAVLGGYAISLHFQSITE-------EILRHSLDQLIHNVTYKENVQRVSDIFRDRPLEPRKSA 462
                       :::.:|:..       |:.|.::::.:..:.    |.:.....|:|.|      
plant   374 -----------AIYLESVWRIGIQVGGELERGAVERAVKRLI----VDKEGASMRERTL------ 417

  Fly   463 VYWIEYVIRHRGASHMRSAGLDLN 486
                  |::.:..:.:|..|...|
plant   418 ------VLKEKLKASIRGGGSSCN 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt49C1NP_001036565.1 egt 22..504 CDD:223071 63/284 (22%)
UDPGT 37..498 CDD:278624 63/284 (22%)
AT3G46700NP_190254.2 Glycosyltransferase_GTB_type 1..446 CDD:299143 63/284 (22%)
YjiC 7..426 CDD:224732 60/273 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.