DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt49C1 and HYR1

DIOPT Version :9

Sequence 1:NP_001036565.1 Gene:Ugt49C1 / 37421 FlyBaseID:FBgn0034605 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_188813.1 Gene:HYR1 / 821730 AraportID:AT3G21760 Length:485 Species:Arabidopsis thaliana


Alignment Length:298 Identity:64/298 - (21%)
Similarity:117/298 - (39%) Gaps:72/298 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   215 FYEDMDRLLNYFPKMDAVAREFFGPVLTEVPKVKHMERQISVMLLNSHAPLTTARPTVDAMVPVG 279
            |.|....|:|.|.:::..|.:||..|                     .:||    |||..:.||.
plant   212 FRETKGILVNTFAELEPQAMKFFSGV---------------------DSPL----PTVYTVGPVM 251

  Fly   280 GMHIYPPKPLPADMQALL----DGATEGAIFFSLGSNVQSKDMPVEMLRLFLQVFGSLKQRVLWK 340
            .:.|..|.........:|    :...:..:|...||....::...:.:.:.|:..|   .|.:|.
plant   252 NLKINGPNSSDDKQSEILRWLDEQPRKSVVFLCFGSMGGFREGQAKEIAIALERSG---HRFVWS 313

  Fly   341 F-------------EDESISQ-LPDNVMVRK--------WLPQADILAHRHVKVFITHGGLFGTQ 383
            .             |..::.: ||:..:.|.        |.||:.|||:..:..|::|.|...|.
plant   314 LRRAQPKGSIGPPEEFTNLEEILPEGFLERTAEIGKIVGWAPQSAILANPAIGGFVSHCGWNSTL 378

  Fly   384 EGVHYAVPMLGIPFYCDQHLNMNKAVLG-GYAISLH------FQSITEEILRHSLDQLIHNVTYK 441
            |.:.:.|||...|.|.:|.:|..:.|.. |.|:.:.      |.:..:|::  :.:::...:  :
plant   379 ESLWFGVPMATWPLYAEQQVNAFEMVEELGLAVEVRNSFRGDFMAADDELM--TAEEIERGI--R 439

  Fly   442 ENVQRVSDIFRDRPLE-PRKSAVYWIEYVIRHRGASHM 478
            ..:::.||: |.|..| ..||.|     .:...|:||:
plant   440 CLMEQDSDV-RSRVKEMSEKSHV-----ALMDGGSSHV 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt49C1NP_001036565.1 egt 22..504 CDD:223071 64/298 (21%)
UDPGT 37..498 CDD:278624 64/298 (21%)
HYR1NP_188813.1 PLN02554 1..485 CDD:215304 64/298 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.