DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt49C1 and AT2G36970

DIOPT Version :9

Sequence 1:NP_001036565.1 Gene:Ugt49C1 / 37421 FlyBaseID:FBgn0034605 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_181234.1 Gene:AT2G36970 / 818271 AraportID:AT2G36970 Length:490 Species:Arabidopsis thaliana


Alignment Length:519 Identity:106/519 - (20%)
Similarity:189/519 - (36%) Gaps:152/519 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LELAEGSK-ILAVYAFPGKSHFMMHTALIRELVESGHQVTMVTAFSLEKEQLGSNYTEILIEPVY 82
            :|.|:..| .:.:..:|.:.|.:....|..:|...|..:|.|...|:......::..:       
plant     1 MERAKSRKPHIMMIPYPLQGHVIPFVHLAIKLASHGFTITFVNTDSIHHHISTAHQDD------- 58

  Fly    83 DFWHDVKLNFGAQHLFELTRMTNYDFLKMLEIIGLKTTEHALRQPKV---------RSLIHAEQK 138
                       |..:|...|.:.               :|.:|...|         |||.|.:..
plant    59 -----------AGDIFSAARSSG---------------QHDIRYTTVSDGFPLDFDRSLNHDQFF 97

  Fly   139 EGVF--------DL--------------LLAEQFY------------------QEAFLALAHLYK 163
            ||:.        ||              |:|:.||                  .|..|.|...|.
plant    98 EGILHVFSAHVDDLIAKLSRRDDPPVTCLIADTFYVWSSMICDKHNLVNVSFWTEPALVLNLYYH 162

  Fly   164 IPVVTTSTLGYENHMSQMMGLITPWSFVP--HGFMPFTDRMSFLERVKNSYASFYEDMD------ 220
            :.::.::  |:...:.....:|   .:||  ....| .|.||:|: |.:      :|:|      
plant   163 MDLLISN--GHFKSLDNRKDVI---DYVPGVKAIEP-KDLMSYLQ-VSD------KDVDTNTVVY 214

  Fly   221 RLLNYFPKMDAVAREFFGPVLTEVPKVKHMERQISVMLLNSHAPLTTARP--TVDAMVPVGGMHI 283
            |:|  |.....|.|..|....|    |:.:|.. |:..|.:..|:....|  :.|::||....  
plant   215 RIL--FKAFKDVKRADFVVCNT----VQELEPD-SLSALQAKQPVYAIGPVFSTDSVVPTSLW-- 270

  Fly   284 YPPKPLPADMQALLDGATEGAIFF-SLGS--NVQSKDMPVEMLRLFLQVFGSLKQRV--LWKFED 343
                 ..:|....|.|...|::.: |.||  :|..|:: ||:      ..|.|...:  :|....
plant   271 -----AESDCTEWLKGRPTGSVLYVSFGSYAHVGKKEI-VEI------AHGLLLSGISFIWVLRP 323

  Fly   344 ESI-SQLPDNV------------MVRKWLPQADILAHRHVKVFITHGGLFGTQEGVHYAVPMLGI 395
            :.: |.:||.:            :|.:|..|.:::::..|..|.||.|.....|.|...:|:|..
plant   324 DIVGSNVPDFLPAGFVDQAQDRGLVVQWCCQMEVISNPAVGGFFTHCGWNSILESVWCGLPLLCY 388

  Fly   396 PFYCDQHLNMNKAVLGGYAISLHF---QSITEEILRHSLDQLIHNVTYKE---NVQRVSDIFRD 453
            |...||..| .|.|:..:.|.::.   ::||.:.:..::.:|::..|..|   ||::|....:|
plant   389 PLLTDQFTN-RKLVVDDWCIGINLCEKKTITRDQVSANVKRLMNGETSSELRNNVEKVKRHLKD 451

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt49C1NP_001036565.1 egt 22..504 CDD:223071 105/516 (20%)
UDPGT 37..498 CDD:278624 102/500 (20%)
AT2G36970NP_181234.1 Glycosyltransferase_GTB_type 1..470 CDD:299143 106/519 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.