DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt49C1 and UGT84B1

DIOPT Version :9

Sequence 1:NP_001036565.1 Gene:Ugt49C1 / 37421 FlyBaseID:FBgn0034605 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_179907.1 Gene:UGT84B1 / 816858 AraportID:AT2G23260 Length:456 Species:Arabidopsis thaliana


Alignment Length:414 Identity:84/414 - (20%)
Similarity:143/414 - (34%) Gaps:130/414 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 IGLKTTEHALRQPKVRSLIHAEQKEGV-FDLLLAEQFYQEAF---------LALAHLYKIPVVTT 169
            |.|.|.|.|      |.|:...:|... .||:    |:.:..         ..|..|.|:..:..
plant    41 INLATIESA------RDLLSTVEKPRYPVDLV----FFSDGLPKEDPKAPETLLKSLNKVGAMNL 95

  Fly   170 STLGYENHMSQMMGL-ITPWSFVPHGFMPFTDRMSFL-ERVKNSYASFYEDMDRLLNYFPKMDAV 232
            |.:..|...|.::.. .|||  ||..........:.| .:...:|:.:|       .|:.|.:: 
plant    96 SKIIEEKRYSCIISSPFTPW--VPAVAASHNISCAILWIQACGAYSVYY-------RYYMKTNS- 150

  Fly   233 AREFFGPVLTEVPKVKHMERQISVMLLNSHAPLTTARPTVDAMVPVGGMHIY------------- 284
                       .|.::.:.:.:.:..|    ||...|.....|:|.||.|.|             
plant   151 -----------FPDLEDLNQTVELPAL----PLLEVRDLPSFMLPSGGAHFYNLMAEFADCLRYV 200

  Fly   285 --------------------------PPKPLPADM------QALLDG------------------ 299
                                      |..||.:..      :..|||                  
plant   201 KWVLVNSFYELESEIIESMADLKPVIPIGPLVSPFLLGDGEEETLDGKNLDFCKSDDCCMEWLDK 265

  Fly   300 -ATEGAIFFSLGSNVQSKDMPVEMLRLFLQVFGSLKQR---VLW----KFEDESISQLPDNV--- 353
             |....::.|.||.:::.:..||      .:..:||.|   .||    |.:.::::.|.:.|   
plant   266 QARSSVVYISFGSMLETLENQVE------TIAKALKNRGLPFLWVIRPKEKAQNVAVLQEMVKEG 324

  Fly   354 --MVRKWLPQADILAHRHVKVFITHGGLFGTQEGVHYAVPMLGIPFYCDQHLNMNKAV-LGGYAI 415
              :|.:|.||..||:|..:..|:||.|...|.|.|...||::..|.:.||.::....| :.|..:
plant   325 QGVVLEWSPQEKILSHEAISCFVTHCGWNSTMETVVAGVPVVAYPSWTDQPIDARLLVDVFGIGV 389

  Fly   416 SLHFQSITEEILRHSLDQLIHNVT 439
            .:...|:..|:....:::.|..||
plant   390 RMRNDSVDGELKVEEVERCIEAVT 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt49C1NP_001036565.1 egt 22..504 CDD:223071 84/414 (20%)
UDPGT 37..498 CDD:278624 84/414 (20%)
UGT84B1NP_179907.1 PLN02210 1..456 CDD:215127 84/414 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.