DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt49C1 and T19H12.12

DIOPT Version :9

Sequence 1:NP_001036565.1 Gene:Ugt49C1 / 37421 FlyBaseID:FBgn0034605 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_001024147.2 Gene:T19H12.12 / 3565072 WormBaseID:WBGene00044282 Length:153 Species:Caenorhabditis elegans


Alignment Length:151 Identity:31/151 - (20%)
Similarity:51/151 - (33%) Gaps:22/151 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 SKILAVYAFPGKSHFMMHTALIRELVESGHQVTMVTAFSLEKEQLGSNYTEILIEPVYDFWHDVK 89
            ||||......|.||....:.:...:.:.||.||:...:.:..:.|........||         .
 Worm    19 SKILIFNPIYGFSHVKFISKVADIIADHGHHVTLFQPYHIALKNLDGLVKNKNIE---------I 74

  Fly    90 LNFGAQHLFELTRMTNYDFLKMLEIIGLKTTEHALRQPKVRSLIHAEQKEGVFDLLLAEQFYQEA 154
            ||:...|..||.:.....|....:       .|.:..|.:.:.:..:...|.|.:...|......
 Worm    75 LNYHPTHYEELLKAEPQAFSFFWD-------SHLVGNPVIGAFLMPKLIGGEFKITAMEVLSDRN 132

  Fly   155 FLAL------AHLYKIPVVTT 169
            .|.|      |.|.|:..::|
 Worm   133 MLKLQFVLKHARLIKVGGIST 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt49C1NP_001036565.1 egt 22..504 CDD:223071 31/151 (21%)
UDPGT 37..498 CDD:278624 26/139 (19%)
T19H12.12NP_001024147.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160161662
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000004
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100052
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.