DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt49B1 and UGT74B1

DIOPT Version :9

Sequence 1:NP_611563.1 Gene:Ugt49B1 / 37420 FlyBaseID:FBgn0027073 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_173820.1 Gene:UGT74B1 / 839022 AraportID:AT1G24100 Length:460 Species:Arabidopsis thaliana


Alignment Length:173 Identity:47/173 - (27%)
Similarity:78/173 - (45%) Gaps:26/173 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   324 KVFLEVFGSLKQ---RVLWKFEDESLPNLPA--------NVKVQSWLPQGDILAHPNVKVFIAHG 377
            |...||..:|::   ..||..::..:..||.        ...:.||..|.::|||.::..|:.|.
plant   291 KQLAEVAIALQESDLNFLWVIKEAHIAKLPEGFVESTKDRALLVSWCNQLEVLAHESIGCFLTHC 355

  Fly   378 GLFGTQEAVYNGVPILGMPVYCDQHQNINQGKSAEYALGLDYRK--------VTVEELRGLLMEL 434
            |...|.|.:..|||::|:|.:.||   :|..|..|....:.||.        |..|||...|..:
plant   356 GWNSTLEGLSLGVPMVGVPQWSDQ---MNDAKFVEEVWKVGYRAKEEAGEVIVKSEELVRCLKGV 417

  Fly   435 IENPKYRNNIKKASRIFRDRPLGAMD---TAIYWINYVIEHRG 474
            :|. :....|:::|:.::|..:.||.   ::...||..||..|
plant   418 MEG-ESSVKIRESSKKWKDLAVKAMSEGGSSDRSINEFIESLG 459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt49B1NP_611563.1 egt 7..513 CDD:223071 47/173 (27%)
UDPGT 38..515 CDD:278624 47/173 (27%)
UGT74B1NP_173820.1 Glycosyltransferase_GTB-type 7..455 CDD:415824 44/167 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.