DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt49B1 and UGT85A3

DIOPT Version :9

Sequence 1:NP_611563.1 Gene:Ugt49B1 / 37420 FlyBaseID:FBgn0027073 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_173655.2 Gene:UGT85A3 / 838845 AraportID:AT1G22380 Length:488 Species:Arabidopsis thaliana


Alignment Length:524 Identity:95/524 - (18%)
Similarity:185/524 - (35%) Gaps:173/524 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 FPGKSHFMMTNAIIRELVKQGHEVTFI-TPFS---LAKEKLGSNYKEIVIPQYDF---------- 84
            :|.:.|......:.:.|..:|..|||: |.::   |.:.: |:|..: .:|.:.|          
plant    19 YPAQGHINPMMKVAKLLHVKGFHVTFVNTVYNHNRLLRSR-GANALD-GLPSFQFESIPDGLPET 81

  Fly    85 -------WPEIKEMTNKNTVLEMTDLPTFAFLRMVNVMGIHTTDFALEQPEIQAVINEKNKIGKY 142
                   .|.:.|.|.||.::....|          :..|.|.:   :.|.:..::::.:.  .:
plant    82 GVDATQDIPALSESTTKNCLVPFKKL----------LQRIVTRE---DVPPVSCIVSDGSM--SF 131

  Fly   143 DLLLAEQFFNEGALILGHLYQIPTITISTFGNANHLSQLFGVVSPWSYVPHAYMPYTDRMTLWER 207
            .|.:||:        ||    :|.|...|......::.|           |.|            
plant   132 TLDVAEE--------LG----VPEIHFWTTSACGFMAYL-----------HFY------------ 161

  Fly   208 IGNVAMSAAEDLVREFSYYPGQDA--VLKKHFSKLLDRVPTIKELE------------------- 251
                       |..|....|.:||  :.|::...::|.:|::..::                   
plant   162 -----------LFIEKGLCPVKDASCLTKEYLDTVIDWIPSMNNVKLKDIPSFIRTTNPNDIMLN 215

  Fly   252 ---------RNISAILLNSY--------MPLASSRPMAYNMIPVGGLHIQPPKALPEHLQKFLDG 299
                     :..|||:||::        ..:.|..|..|   |:|.||:...:.:.|..:....|
plant   216 FVVREACRTKRASAIILNTFDDLEHDIIQSMQSILPPVY---PIGPLHLLVNREIEEDSEIGRMG 277

  Fly   300 AT-----------------HGAIYFSLGSQVRSADLPPEKLKVFLEVFGSLKQRVLWKFEDESLP 347
            :.                 :..:|.:.||   ...:...:|..|.....:..:..||....:|:.
plant   278 SNLWKEETECLGWLNTKSRNSVVYVNFGS---ITIMTTAQLLEFAWGLAATGKEFLWVMRPDSVA 339

  Fly   348 NLPANV------------KVQSWLPQGDILAHPNVKVFIAHGGLFGTQEAVYNGVPILGMPVYCD 400
            ...|.:            .:.||.||..:|:||.|..|:.|.|...|.|::..|||::..|.:.:
plant   340 GEEAVIPKEFLAETADRRMLTSWCPQEKVLSHPAVGGFLTHCGWNSTLESLSCGVPMVCWPFFAE 404

  Fly   401 QHQNINQGKSAEYALGLDY-RKVTVEELRGLLMELIENPK----------YRNNIKKASRIFRDR 454
            |..|. :....|:.:|::. ..|...|:..::.||::..|          :|...:||:::    
plant   405 QQTNC-KFSCDEWEVGIEIGGDVKRGEVEAVVRELMDGEKGKKMREKAVEWRRLAEKATKL---- 464

  Fly   455 PLGA 458
            |.|:
plant   465 PCGS 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt49B1NP_611563.1 egt 7..513 CDD:223071 95/524 (18%)
UDPGT 38..515 CDD:278624 94/520 (18%)
UGT85A3NP_173655.2 Glycosyltransferase_GTB_type 9..478 CDD:299143 95/524 (18%)
MGT 20..459 CDD:273616 91/508 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.