DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt49B1 and UGT85A2

DIOPT Version :9

Sequence 1:NP_611563.1 Gene:Ugt49B1 / 37420 FlyBaseID:FBgn0027073 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_173653.1 Gene:UGT85A2 / 838843 AraportID:AT1G22360 Length:481 Species:Arabidopsis thaliana


Alignment Length:495 Identity:97/495 - (19%)
Similarity:180/495 - (36%) Gaps:143/495 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 FPGKSHFMMTNAIIRELVKQGHEVTFITPFSLAKEKLGSNYKEIV--IPQYDF------WPEIKE 90
            :|.:.|......:.:.|..:|..:||:.........|.|.....|  :|.:.|      .||   
plant    16 YPAQGHINPMMKVAKLLYAKGFHITFVNTVYNHNRLLRSRGPNAVDGLPSFRFESIPDGLPE--- 77

  Fly    91 MTNKNTVLEMT-DLPTFAFLRMVNVMGIHTTDFALEQP--EIQAVINEKNKIGKYDLLLAE---Q 149
                 |.:::| |:||.....|.:.:.          |  |:...||.::.:.....::::   .
plant    78 -----TDVDVTQDIPTLCESTMKHCLA----------PFKELLRQINARDDVPPVSCIVSDGCMS 127

  Fly   150 FFNEGALILGHLYQIPTITISTFGNANHLSQLFGVVSPWSYVPHAYMPYTDRMTLWERIGNVAMS 214
            |..:.|..||    :|.:             ||...|...::.:.|         :.|.....:|
plant   128 FTLDAAEELG----VPEV-------------LFWTTSACGFLAYLY---------YYRFIEKGLS 166

  Fly   215 AAEDLVREFSYYPGQDAVLKKHFSKLLDRVPTIKELE---------------------------- 251
            ..:|          :..:.|:|....:|.:|::|.|.                            
plant   167 PIKD----------ESYLTKEHLDTKIDWIPSMKNLRLKDIPSFIRTTNPDDIMLNFIIREADRA 221

  Fly   252 RNISAILLNSY--------MPLASSRPMAYNMIPVGGLHIQPPKALPEHLQ-------------K 295
            :..|||:||::        ..:.|..|..|:   :|.||:...:...|:.:             :
plant   222 KRASAIILNTFDDLEHDVIQSMKSIVPPVYS---IGPLHLLEKQESGEYSEIGRTGSNLWREETE 283

  Fly   296 FLD----GATHGAIYFSLGS-QVRSADLPPEKLKVFLEVFGSLKQRVLWKFEDESLPNLPANV-- 353
            .||    .|.:..:|.:.|| .|.||    ::|..|.....:..:..||....:.:....|.|  
plant   284 CLDWLNTKARNSVVYVNFGSITVLSA----KQLVEFAWGLAATGKEFLWVIRPDLVAGDEAMVPP 344

  Fly   354 ----------KVQSWLPQGDILAHPNVKVFIAHGGLFGTQEAVYNGVPILGMPVYCDQHQNINQG 408
                      .:.||.||..:|:||.:..|:.|.|...|.|::..|||::..|.:.:|..|....
plant   345 EFLTATADRRMLASWCPQEKVLSHPAIGGFLTHCGWNSTLESLCGGVPMVCWPFFAEQQTNCKFS 409

  Fly   409 KSAEYALGLDY-RKVTVEELRGLLMELIENPKYRNNIKKA 447
            :. |:.:|::. ..|..||:..::.||::..|.:|..:||
plant   410 RD-EWEVGIEIGGDVKREEVEAVVRELMDEEKGKNMREKA 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt49B1NP_611563.1 egt 7..513 CDD:223071 97/495 (20%)
UDPGT 38..515 CDD:278624 96/491 (20%)
UGT85A2NP_173653.1 Glycosyltransferase_GTB-type 8..475 CDD:385653 97/495 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.