DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt49B1 and UGT71C3

DIOPT Version :9

Sequence 1:NP_611563.1 Gene:Ugt49B1 / 37420 FlyBaseID:FBgn0027073 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_172206.1 Gene:UGT71C3 / 837237 AraportID:AT1G07260 Length:476 Species:Arabidopsis thaliana


Alignment Length:485 Identity:112/485 - (23%)
Similarity:178/485 - (36%) Gaps:109/485 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 FPGKSHFMMTNAIIRELVKQGHEVTFIT------PFS-----LAKEKLGS--NYKEIVIPQYD-- 83
            :|...|.:::....:.|:|:...:..||      |.:     .||..:.|  ..:.:.:|...  
plant    12 YPSPGHLLVSIEFAKSLIKRDDRIHTITILYWALPLAPQAHLFAKSLVASQPRIRLLALPDVQNP 76

  Fly    84 -----FW--PE--IKEMTNKNTVLEMTDLPTFAFLR----MVNVMGIHTTDFALEQPEIQAVINE 135
                 |:  ||  |.|.|.|...|....|.|....|    .|.|:|:....|.:  |.|: |.||
plant    77 PPLELFFKAPEAYILESTKKTVPLVRDALSTLVSSRKESGSVRVVGLVIDFFCV--PMIE-VANE 138

  Fly   136 KNKIGKYDLLLAEQFFNEGALILGHLYQIPTITIS-TFGNANH------LSQLFGVVSPWSYVPH 193
            .| :..|..|.....|......|...::|.|..:. :.||..|      .|....|:.|..:|..
plant   139 LN-LPSYIFLTCNAGFLSMMKYLPERHRITTSELDLSSGNVEHPIPGYVCSVPTKVLPPGLFVRE 202

  Fly   194 AYMPYTDRMTLWERIGNVAMSAAEDLVREFSYYPGQDAVLKKHFSKLLDRVPTIKELERNISAIL 258
            :|       ..|..|       ||.       :||...:|          |.::..||:|    .
plant   203 SY-------EAWVEI-------AEK-------FPGAKGIL----------VNSVTCLEQN----A 232

  Fly   259 LNSYMPLASSRPMAYNMIPVGGLHIQPPKALP----EHLQKFLDGATHGAI-YFSLGSQVRSADL 318
            .:.:..|..:.|..|.:.||..|..:|...|.    :.:.::|:.....:| |...||......|
plant   233 FDYFARLDENYPPVYPVGPVLSLKDRPSPNLDASDRDRIMRWLEDQPESSIVYICFGSLGIIGKL 297

  Fly   319 PPEKLKVFLEVFGSLKQRVLWKFE--------------DESLPNLPANVKVQSWLPQGDILAHPN 369
            ..|::...||:.|   .|.||...              :..|....:...|..|.||.::|||..
plant   298 QIEEIAEALELTG---HRFLWSIRTNPTEKASPYDLLPEGFLDRTASKGLVCDWAPQVEVLAHKA 359

  Fly   370 VKVFIAHGGLFGTQEAVYNGVPILGMPVYCDQHQNI-----NQGKSAEYALGLDY-----RKVTV 424
            :..|::|.|.....|:::.||||...|:|.:|..|.     ..|.:.|  |.|||     ..|..
plant   360 LGGFVSHCGWNSVLESLWFGVPIATWPMYAEQQLNAFSMVKELGLAVE--LRLDYVSAYGEIVKA 422

  Fly   425 EELRGLLMELIENPKY-RNNIKKASRIFRD 453
            ||:.|.:..|::.... |..:|:.:...|:
plant   423 EEIAGAIRSLMDGEDTPRKRVKEMAEAARN 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt49B1NP_611563.1 egt 7..513 CDD:223071 112/485 (23%)
UDPGT 38..515 CDD:278624 111/481 (23%)
UGT71C3NP_172206.1 PLN02167 2..476 CDD:215112 112/485 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.