DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt49B1 and AT5G37950

DIOPT Version :9

Sequence 1:NP_611563.1 Gene:Ugt49B1 / 37420 FlyBaseID:FBgn0027073 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_198611.1 Gene:AT5G37950 / 833774 AraportID:AT5G37950 Length:351 Species:Arabidopsis thaliana


Alignment Length:389 Identity:83/389 - (21%)
Similarity:139/389 - (35%) Gaps:112/389 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 FSLAKEKLGSNY----KEIVIPQYDFWPEIKEMTNKNTVLEMTDLPTFA---FLRMVN------- 113
            ||:...:...||    |::...|:...||         .|..:||.|..   |:..:|       
plant    13 FSITVAQTKFNYLNPSKDLADFQFITIPE---------SLPASDLKTLGPIWFIIKLNKECEISF 68

  Fly   114 --VMGIHTTDFAL-EQPEIQAVINEKNKIGKYDLLLAEQFFNEGALILGHLYQIPTITIST---- 171
              .:|    .|.| :|.||..||        ||..:   :|.|.|   ...:.:|.:..||    
plant    69 KKCLG----QFLLQQQEEIACVI--------YDEFM---YFAEAA---AKEFNLPKVIFSTENAT 115

  Fly   172 -FGNANHLSQLFGVVSPWSYVPHAYMPYTDRMTLWERIGNVAMSAAEDLVREF-----------S 224
             |...:.:.:|        |......|.|:           .....|:||.|.           :
plant   116 AFACRSAMCKL--------YAKDGIAPLTE-----------GCGREEELVPELHPLRYKDLPTSA 161

  Fly   225 YYPGQDAVLKKHFSKLLDRVPTIKELERNISAILLNSYMPLASSRPMAYNMIPVGGLHI---QPP 286
            :.|.:.:|  :.|....::......:...:|.:.::|...|  .:.:...:.|:|.|::   .||
plant   162 FAPVEASV--EVFKSSCEKGTASSMIINTVSCLEISSLEWL--QQELKIPIYPIGPLYMVSSAPP 222

  Fly   287 KALPEHLQKFLDGAT----HGAIYFSLGSQVRSADLPPEKLKVFLEVFGSL---KQRVLW----- 339
            .:|.:..:..:|...    ...||.||||      ....:.|..||:...|   .|..||     
plant   223 TSLLDENESCIDWLNKQKPSSVIYISLGS------FTLLETKEVLEMASGLVSSNQYFLWAIRPG 281

  Fly   340 -----KFEDE---SLPNLPANVKVQSWLPQGDILAHPNVKVFIAHGGLFGTQEAVYNGVPILGM 395
                 :..:|   |:..:|....:..|..|..:|||..|..|.:|.|...|.|::..|:||:|:
plant   282 SILGSELSNEELFSMMEIPDRGYIVKWATQKQVLAHAAVGAFWSHCGWNSTLESIGEGIPIVGL 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt49B1NP_611563.1 egt 7..513 CDD:223071 83/389 (21%)
UDPGT 38..515 CDD:278624 83/389 (21%)
AT5G37950NP_198611.1 Glycosyltransferase_GTB_type 1..343 CDD:299143 81/385 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.