DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt49B1 and AT5G05880

DIOPT Version :9

Sequence 1:NP_611563.1 Gene:Ugt49B1 / 37420 FlyBaseID:FBgn0027073 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_196207.1 Gene:AT5G05880 / 830473 AraportID:AT5G05880 Length:451 Species:Arabidopsis thaliana


Alignment Length:236 Identity:56/236 - (23%)
Similarity:91/236 - (38%) Gaps:50/236 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   260 NSYMPLASSRPMAYNMIPVGGLHIQPPKALPEHLQKFLDGATHGAIYFSLGSQVRSADLPPEKLK 324
            :|:.|.:||.....:...:..|..|..|::               ||.|:||.|...:..     
plant   237 HSHFPASSSSLFTPDETCIPWLDRQEDKSV---------------IYVSIGSLVTINETE----- 281

  Fly   325 VFLEVFGSLK---QRVLWKFE---------DESLP-----NLPANVKVQSWLPQGDILAHPNVKV 372
             .:|:...|.   |..||...         .|::|     .|....|:..|.||.::|.|..:..
plant   282 -LMEIAWGLSNSDQPFLWVVRVGSVNGTEWIEAIPEYFIKRLNEKGKIVKWAPQQEVLKHRAIGG 345

  Fly   373 FIAHGGLFGTQEAVYNGVPILGMPVYCDQHQNINQGKSAEYALGLDYR-KVTVEE----LRGLLM 432
            |:.|.|...|.|:|..|||::.:|...||..|. :..|..:.:|:... ::..:|    :|.||:
plant   346 FLTHNGWNSTVESVCEGVPMICLPFRWDQLLNA-RFVSDVWMVGIHLEGRIERDEIERAIRRLLL 409

  Fly   433 ELIENPKYRNNI----KKASRIFRDRPLGAMDTAIYWINYV 469
            | .|....|..|    :|..|..:... .|..:....|||:
plant   410 E-TEGEAIRERIQLLKEKVGRSVKQNG-SAYQSLQNLINYI 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt49B1NP_611563.1 egt 7..513 CDD:223071 56/236 (24%)
UDPGT 38..515 CDD:278624 56/236 (24%)
AT5G05880NP_196207.1 Glycosyltransferase_GTB-type 2..451 CDD:385653 56/236 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.