DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt49B1 and AT4G36770

DIOPT Version :9

Sequence 1:NP_611563.1 Gene:Ugt49B1 / 37420 FlyBaseID:FBgn0027073 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_195395.4 Gene:AT4G36770 / 829830 AraportID:AT4G36770 Length:457 Species:Arabidopsis thaliana


Alignment Length:352 Identity:74/352 - (21%)
Similarity:128/352 - (36%) Gaps:121/352 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   201 RMTLWERIGNVAMSAAEDLVREFSYYPGQDAVLKKH--------------FSKLLDRVPTIKELE 251
            |:.:.:.:|..|:..|::|           .:::||              :...||:....|:|.
plant   107 RVFVVDLLGTEALEVAKEL-----------GIMRKHVLVTTSAWFLAFTVYMASLDKQELYKQLS 160

  Fly   252 RNISAILLNSYMP---------------LASSRPMAYNMIPVGGLHIQPPKAL----------PE 291
             :|.|:|:....|               ||.|:.:...:|...|:.:....:|          ||
plant   161 -SIGALLIPGCSPVKFERAQDPRKYIRELAESQRIGDEVITADGVFVNTWHSLEQVTIGSFLDPE 224

  Fly   292 HLQKFLDGATHGAIYFSLGSQVRSA------------DLPPEKLKVFLEVFGS------------ 332
            :|.:.:    .|...:.:|..||.|            ||.|::..|::. |||            
plant   225 NLGRVM----RGVPVYPVGPLVRPAEPGLKHGVLDWLDLQPKESVVYVS-FGSGGALTFEQTNEL 284

  Fly   333 ------LKQRVLW------------------KFEDESLPNLP---------ANVKVQSWLPQGDI 364
                  ...|.:|                  |.|.|.|..||         ..:.|::|.||.:|
plant   285 AYGLELTGHRFVWVVRPPAEDDPSASMFDKTKNETEPLDFLPNGFLDRTKDIGLVVRTWAPQEEI 349

  Fly   365 LAHPNVKVFIAHGGLFGTQEAVYNGVPILGMPVYCDQHQNINQGKSAEYALGLD-------YRKV 422
            |||.:...|:.|.|.....|::.||||::..|:|.:|..|... .|.|..:.|.       .:|.
plant   350 LAHKSTGGFVTHCGWNSVLESIVNGVPMVAWPLYSEQKMNARM-VSGELKIALQINVADGIVKKE 413

  Fly   423 TVEELRGLLMELIENPKYRNNIKKASR 449
            .:.|:...:|:..|..:.|.|:|:..:
plant   414 VIAEMVKRVMDEEEGKEMRKNVKELKK 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt49B1NP_611563.1 egt 7..513 CDD:223071 74/352 (21%)
UDPGT 38..515 CDD:278624 74/352 (21%)
AT4G36770NP_195395.4 Glycosyltransferase_GTB_type 4..448 CDD:299143 74/352 (21%)
YjiC 6..451 CDD:224732 74/352 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.