DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt49B1 and AT4G15260

DIOPT Version :9

Sequence 1:NP_611563.1 Gene:Ugt49B1 / 37420 FlyBaseID:FBgn0027073 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_193261.2 Gene:AT4G15260 / 827192 AraportID:AT4G15260 Length:359 Species:Arabidopsis thaliana


Alignment Length:377 Identity:83/377 - (22%)
Similarity:131/377 - (34%) Gaps:129/377 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   191 VPHAYMPYTDRMTLWERIG------------NVAMSAAEDLVREFSY------YP---------G 228
            || .||.||...|.   :|            ...:|..::.|.|..:      ||         .
plant    15 VP-CYMIYTSNATF---LGITLHVQEMYDDKKYDVSDLDESVNELEFPCLTRPYPVKCLPHILSS 75

  Fly   229 QD-----AVLKKHFSKLLD-RVPTIKELERNISAILLNSYMPLASSRPMAYNMIPVGGLHI---- 283
            :|     |...:.|.|:.. .|.|:.|||.:...:..|..:      |.||.:.||  ||:    
plant    76 KDWLPFFAAQGRSFRKMKGILVNTVAELEPHALKMFNNVDL------PQAYPVGPV--LHLDNGD 132

  Fly   284 ---------------QPPKALPEHLQKFLDGATHGAIYFSLGSQVRSADLPPEKLKVFLEVFGSL 333
                           ||||::               ::...||.....:....::.|.|...|  
plant   133 DDDEKRLEVLRWLDDQPPKSV---------------LFLCFGSMGGFTEEQTREVAVALNRSG-- 180

  Fly   334 KQRVLWKFEDESLPNL----PANV-------------------KVQSWLPQGDILAHPNVKVFIA 375
             .|.||.....| ||:    |.:.                   ||..|.||..:|..|.:..|:.
plant   181 -HRFLWSLRRAS-PNIMMERPGDYKNLEEVLPDGFLERTLDRGKVIGWAPQVAVLEKPAIGGFVT 243

  Fly   376 HGGLFGTQEAVYNGVPILGMPVYCDQHQNINQGKSAEYALGLDYRK--------------VTVEE 426
            |.|.....|:::.|||::..|:|.:|..|..: ...|..|.::.||              ||.|:
plant   244 HCGWNSMLESLWFGVPMVTWPLYAEQKVNAFE-MVEELGLAVEIRKCISGDLLLIGEMEIVTAED 307

  Fly   427 L-RGLLMELIENPKYRNNIK----KASRIFRDRPLGAMDTAIY-WINYVIEH 472
            : |.:...:.::...|:.:|    |......|.  |:..||:. :|..|||:
plant   308 IERAIRCVMEQDSDVRSRVKEMAEKCHVALMDG--GSSKTALQKFIQDVIEN 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt49B1NP_611563.1 egt 7..513 CDD:223071 83/377 (22%)
UDPGT 38..515 CDD:278624 83/377 (22%)
AT4G15260NP_193261.2 Glycosyltransferase_GTB_type <1..359 CDD:299143 83/377 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.