DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt49B1 and AT3G46650

DIOPT Version :9

Sequence 1:NP_611563.1 Gene:Ugt49B1 / 37420 FlyBaseID:FBgn0027073 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_190249.4 Gene:AT3G46650 / 823818 AraportID:AT3G46650 Length:435 Species:Arabidopsis thaliana


Alignment Length:447 Identity:99/447 - (22%)
Similarity:166/447 - (37%) Gaps:119/447 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 QGHEVTFITPFSLAKEKLGSNYKEIVIPQYDF---------WPEIKEMTNKNTVLEMTDLPTFAF 108
            |||    :||.....:.|.|....|.:.:..|         :|..:.:|.|.:      ||...|
plant    19 QGH----VTPLMQLGKVLNSKGFSITVVEGHFNQVSSSSQHFPGFQFVTIKES------LPESEF 73

  Fly   109 LRMVNVMGI----HTTDFALEQPEIQAVINEKNKIG--KYDLLLAEQFFNEGALILGHLYQIPTI 167
            .::..:..:    .|::.:.:....|.::.:.|.|.  .||    |..:..||  ....:.||::
plant    74 EKLGGIESMITLNKTSEASFKDCISQLLLQQGNDIACIIYD----EYMYFCGA--AAKEFSIPSV 132

  Fly   168 TISTFGNANHLSQLFGVVSPWSYVPHAYMPYTDRMTLWERIGNVAMSAAEDLVREFSYYPGQDAV 232
            ..||...||             ||.|..|                    :|.|.| :.||.:...
plant   133 IFSTQSAAN-------------YVSHPDM--------------------QDKVVE-NLYPLRYKD 163

  Fly   233 LKKHFSKLLDR-VPTIKEL--ERNISAILLNSYMPLASS------RPMAYNMIPVGGLHI--QPP 286
            |.......||| ....:|:  :|..||:::|:...|.||      :.:..::.|:|.||:  ..|
plant   164 LPTSGMGPLDRFFELCREVANKRTASAVIINTVSCLESSSLSWLEQKVGISVYPLGPLHMTDSSP 228

  Fly   287 KALPEHLQKFLDGAT----HGAIYFSLGSQVRSADLPPEKLKVFLEVFGSL---KQRVLWKFEDE 344
            .:|.|..:..::...    ...||.|:|:      |...:.|..||:...|   .|..||.....
plant   229 SSLLEEDRSCIEWLNKQKPKSVIYISIGT------LGQMETKEVLEMSWGLCNSNQPFLWVIRAG 287

  Fly   345 S------LPNLPANVK--------VQSWLPQGDILAHPNVKVFIAHGGLFGTQEAVYNGVPILGM 395
            |      :.:||.:|.        :....||.::|.||.|..|.:|.|.....|::..|||::..
plant   288 SILGTNGIESLPEDVNKMVSERGYIVKRAPQIEVLGHPAVGGFWSHCGWNSILESIGEGVPMICK 352

  Fly   396 PVYCDQHQNIN------------QGKSAEYALGLDYRKVTV----EELRGLLMELIE 436
            |.:.:|..|..            :|.....|:....:::||    ||:|...:.|.|
plant   353 PFHGEQKLNAMYLECVWKIGIQVEGDLERGAVERAVKRLTVFEEGEEMRKRAVTLKE 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt49B1NP_611563.1 egt 7..513 CDD:223071 99/447 (22%)
UDPGT 38..515 CDD:278624 99/447 (22%)
AT3G46650NP_190249.4 Glycosyltransferase_GTB-type 1..435 CDD:385653 99/447 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.