DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt49B1 and AT3G22250

DIOPT Version :9

Sequence 1:NP_611563.1 Gene:Ugt49B1 / 37420 FlyBaseID:FBgn0027073 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_188864.1 Gene:AT3G22250 / 821795 AraportID:AT3G22250 Length:461 Species:Arabidopsis thaliana


Alignment Length:205 Identity:52/205 - (25%)
Similarity:82/205 - (40%) Gaps:53/205 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   274 NMIPVGGLHIQPPKALPEHLQKFLDGATHGAIYFSLGSQVRS-ADLPPEKLKVFLEVFGSLKQRV 337
            :|..:|.|..|.|.::               ||.|.||.|.. .:...:.|.:.||..|   :..
plant   270 DMSCLGWLQEQNPNSV---------------IYISFGSWVSPIGESNIQTLALALEASG---RPF 316

  Fly   338 LWKFE---DESLPNLPANV----------KVQSWLPQGDILAHPNVKVFIAHGGLFGTQEAVYNG 389
            ||...   .|.||  |..|          ::.||.||.::|.:.:|..::.|.|...|.|||.:.
plant   317 LWALNRVWQEGLP--PGFVHRVTITKNQGRIVSWAPQLEVLRNDSVGCYVTHCGWNSTMEAVASS 379

  Fly   390 VPILGMPVYCDQHQNINQGKSAEYALGLDYRKVTV-------EELRGLLMELIENPKYRNNIKKA 447
            ..:|..||..||..|      .:|.  :|..|:.|       :|:...|.:::|:......::| 
plant   380 RRLLCYPVAGDQFVN------CKYI--VDVWKIGVRLSGFGEKEVEDGLRKVMEDQDMGERLRK- 435

  Fly   448 SRIFRDRPLG 457
               .|||.:|
plant   436 ---LRDRAMG 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt49B1NP_611563.1 egt 7..513 CDD:223071 52/205 (25%)
UDPGT 38..515 CDD:278624 52/205 (25%)
AT3G22250NP_188864.1 PLN02562 1..461 CDD:215305 52/205 (25%)
YjiC 6..445 CDD:224732 52/205 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR48043
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.150

Return to query results.
Submit another query.