DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt49B1 and HYR1

DIOPT Version :9

Sequence 1:NP_611563.1 Gene:Ugt49B1 / 37420 FlyBaseID:FBgn0027073 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_188813.1 Gene:HYR1 / 821730 AraportID:AT3G21760 Length:485 Species:Arabidopsis thaliana


Alignment Length:495 Identity:102/495 - (20%)
Similarity:169/495 - (34%) Gaps:155/495 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 HFMMTNAIIREL--VKQGHEVTFITPFSL-AKEKLGSNYKEIVIPQ-----------YD----FW 85
            |..:|..||.::  ....:..::|...|. ::|:|  :|..:.:|.           :|    |.
plant    32 HLSITIIIIPQMHGFSSSNSSSYIASLSSDSEERL--SYNVLSVPDKPDSDDTKPHFFDYIDNFK 94

  Fly    86 PEIKEMTNKNTVLEMTDLPTFAFLRMVNVMGIHTTDFALEQPEIQAVINEKNKIGKYDLLLAEQF 150
            |::|....|.|.....|.|:       .:.|.....|.:      .:|:..|:.|    :.:..|
plant    95 PQVKATVEKLTDPGPPDSPS-------RLAGFVVDMFCM------MMIDVANEFG----VPSYMF 142

  Fly   151 FNEGALILG------HLYQIPTITISTFGNANH-------LSQLFGV-VSPWSYVPHAYMPYTDR 201
            :...|..||      :||.:....:|...:::.       |::...| ..|...:...::|...|
plant   143 YTSNATFLGLQVHVEYLYDVKNYDVSDLKDSDTTELEVPCLTRPLPVKCFPSVLLTKEWLPVMFR 207

  Fly   202 MTLWERIGNVAMSAAEDLVREFSYYPGQDAVLKKHFSKLLDRVPTIKELERNISAILLNSYMPLA 266
            .|                 |.|....|   :|          |.|..|||............|| 
plant   208 QT-----------------RRFRETKG---IL----------VNTFAELEPQAMKFFSGVDSPL- 241

  Fly   267 SSRPMAYNMIPVGGLHIQPPKALPEHLQKFLDGATHGAIYFSLGSQVRSADLPPEKLKVFLEVFG 331
               |..|.:.||..|.|..|.:..:...:.|                |..|..|.|..||| .||
plant   242 ---PTVYTVGPVMNLKINGPNSSDDKQSEIL----------------RWLDEQPRKSVVFL-CFG 286

  Fly   332 SL------------------KQRVLWKFE-----------------DESLP----NLPANV-KVQ 356
            |:                  ..|.:|...                 :|.||    ...|.: |:.
plant   287 SMGGFREGQAKEIAIALERSGHRFVWSLRRAQPKGSIGPPEEFTNLEEILPEGFLERTAEIGKIV 351

  Fly   357 SWLPQGDILAHPNVKVFIAHGGLFGTQEAVYNGVPILGMPVYCDQHQNINQ-----GKSAEYA-- 414
            .|.||..|||:|.:..|::|.|...|.|:::.|||:...|:|.:|..|..:     |.:.|..  
plant   352 GWAPQSAILANPAIGGFVSHCGWNSTLESLWFGVPMATWPLYAEQQVNAFEMVEELGLAVEVRNS 416

  Fly   415 -----LGLDYRKVTVEEL-RGLLMELIENPKYRNNIKKAS 448
                 :..|...:|.||: ||:...:.::...|:.:|:.|
plant   417 FRGDFMAADDELMTAEEIERGIRCLMEQDSDVRSRVKEMS 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt49B1NP_611563.1 egt 7..513 CDD:223071 102/495 (21%)
UDPGT 38..515 CDD:278624 102/495 (21%)
HYR1NP_188813.1 PLN02554 1..485 CDD:215304 102/495 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.