DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt49B1 and UGT88A1

DIOPT Version :9

Sequence 1:NP_611563.1 Gene:Ugt49B1 / 37420 FlyBaseID:FBgn0027073 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_566550.1 Gene:UGT88A1 / 820900 AraportID:AT3G16520 Length:462 Species:Arabidopsis thaliana


Alignment Length:327 Identity:76/327 - (23%)
Similarity:119/327 - (36%) Gaps:117/327 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 FFNEGALILGHLYQIPTITISTFGNANHLSQLFGVVSPWSYVPHAYMPYTDRMTLWERIGNVAMS 214
            |:..||..|...:.:|||..:|.|  .:|..          :|..::|            .|...
plant   139 FYTSGAACLAFSFYLPTIDETTPG--KNLKD----------IPTVHIP------------GVPPM 179

  Fly   215 AAEDLVREFSYYPGQDAVLKKHFSKLLDRVPTI-----KELERNISAILLNSYMPL------ASS 268
            ...|:.:         |||::.     |.|..:     |:|.:: |.|::|::..|      |.:
plant   180 KGSDMPK---------AVLERD-----DEVYDVFIMFGKQLSKS-SGIIINTFDALENRAIKAIT 229

  Fly   269 RPMAY-NMIPVGGLHIQPPKALPEHLQKFLDGATHGAIYFSLGSQVRSADLPPEKLKVFLEVFGS 332
            ..:.: |:.|:|.|.:.         .:..|...:.|:     |.:...|..|||..||| .|||
plant   230 EELCFRNIYPIGPLIVN---------GRIEDRNDNKAV-----SCLNWLDSQPEKSVVFL-CFGS 279

  Fly   333 L------------------KQRVLW---------KFEDESLPNLP---------ANVKVQSWLPQ 361
            |                  .||.||         |.|.:....||         ..:.|:||.||
plant   280 LGLFSKEQVIEIAVGLEKSGQRFLWVVRNPPELEKTELDLKSLLPEGFLSRTEDKGMVVKSWAPQ 344

  Fly   362 GDILAHPNVKVFIAHGGLFGTQEAVYNGVPILGMPVYCDQHQNINQGKSAEYALGLDYRKVTVEE 426
            ..:|.|..|..|:.|.|.....|||..|||::..|:|.:|..|               |.:.|:|
plant   345 VPVLNHKAVGGFVTHCGWNSILEAVCAGVPMVAWPLYAEQRFN---------------RVMIVDE 394

  Fly   427 LR 428
            ::
plant   395 IK 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt49B1NP_611563.1 egt 7..513 CDD:223071 76/327 (23%)
UDPGT 38..515 CDD:278624 76/327 (23%)
UGT88A1NP_566550.1 PLN03004 1..451 CDD:178581 76/327 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.