DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt49B1 and UGT74F1

DIOPT Version :9

Sequence 1:NP_611563.1 Gene:Ugt49B1 / 37420 FlyBaseID:FBgn0027073 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_181912.1 Gene:UGT74F1 / 818988 AraportID:AT2G43840 Length:449 Species:Arabidopsis thaliana


Alignment Length:499 Identity:96/499 - (19%)
Similarity:167/499 - (33%) Gaps:167/499 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 FPGKSHFMMTNAIIRELVKQGHE-----VTFI---------TPFSLAK----------EKLGSNY 74
            ||.:.|........:.|..:|.:     .|||         :|.|:|.          ...||  
plant    13 FPSQGHITPIRQFCKRLHSKGFKTTHTLTTFIFNTIHLDPSSPISIATISDGYDQGGFSSAGS-- 75

  Fly    75 KEIVIPQYDFWPEIKEMTNKNTVLEMTDLPTFAFLRMVNVMGIH-TTDFALEQPEIQAVINEKNK 138
                :|:|                 :.:..||....:.:::..| :||    .| |..::.:...
plant    76 ----VPEY-----------------LQNFKTFGSKTVADIIRKHQSTD----NP-ITCIVYDSFM 114

  Fly   139 IGKYDL-----LLAEQFF---------------NEGALILG-------HLYQIPTITISTFGNAN 176
            ....||     |.|..||               |.|:|.|.       .|..:||....|   .:
plant   115 PWALDLAMDFGLAAAPFFTQSCAVNYINYLSYINNGSLTLPIKDLPLLELQDLPTFVTPT---GS 176

  Fly   177 HLSQLFGVVSPWSYVPHAYMPYTDRMTLWERIGNVAMSAAEDLVREFSYYPGQDAVLKK------ 235
            ||               ||.                    |.::::|:.:...|.||..      
plant   177 HL---------------AYF--------------------EMVLQQFTNFDKADFVLVNSFHDLD 206

  Fly   236 -HFSKLLDRVPTIKELERNISAILLNSYMPLASSRPMAYNMIPVGGLHIQPPKALPEHLQKFLDG 299
             |..:||.:|..:..:...:.::.|:  ..:.|......|:     ..::......:.|.|..:|
plant   207 LHEEELLSKVCPVLTIGPTVPSMYLD--QQIKSDNDYDLNL-----FDLKEAALCTDWLDKRPEG 264

  Fly   300 ATHGAIYFSLGSQVRSADLPPEKLKVFLEVFGSLKQRVLW---KFEDESLPNLPANVK------- 354
            :   .:|.:.||..:.:....|::...:..|.     .||   ..|:..||  |..::       
plant   265 S---VVYIAFGSMAKLSSEQMEEIASAISNFS-----YLWVVRASEESKLP--PGFLETVDKDKS 319

  Fly   355 -VQSWLPQGDILAHPNVKVFIAHGGLFGTQEAVYNGVPILGMPVYCDQHQN---------INQGK 409
             |..|.||..:|::..:..|:.|.|...|.|.:..|||::.||.:.||..|         :....
plant   320 LVLKWSPQLQVLSNKAIGCFMTHCGWNSTMEGLSLGVPMVAMPQWTDQPMNAKYIQDVWKVGVRV 384

  Fly   410 SAEYALGLDYRKVTVEELRGLLMELIENPKYRNNIKKASRIFRD 453
            .||...|:..|    ||:...:.|::|..|.:...:.|.: :||
plant   385 KAEKESGICKR----EEIEFSIKEVMEGEKSKEMKENAGK-WRD 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt49B1NP_611563.1 egt 7..513 CDD:223071 96/499 (19%)
UDPGT 38..515 CDD:278624 94/495 (19%)
UGT74F1NP_181912.1 PLN02173 1..449 CDD:177830 96/499 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.