DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt49B1 and AT2G31790

DIOPT Version :9

Sequence 1:NP_611563.1 Gene:Ugt49B1 / 37420 FlyBaseID:FBgn0027073 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_180738.1 Gene:AT2G31790 / 817736 AraportID:AT2G31790 Length:457 Species:Arabidopsis thaliana


Alignment Length:265 Identity:62/265 - (23%)
Similarity:115/265 - (43%) Gaps:45/265 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 EDLVREFSYYPGQDAVLKKHFSKLLDRVPTIKELE-----RNISAILLNSYMPLASSRPMAYNMI 276
            |.:||:||.....|.:|...|.:|..:|  :|.:.     :||..::.:.::.         |.:
plant   190 EFVVRQFSNLLQADCILCNTFDQLEPKV--VKWMNDQWPVKNIGPVVPSKFLD---------NRL 243

  Fly   277 PVG-GLHIQPPKALP-EHLQKFL-DGATHGAIYFSLGSQVRSADLPPEKLKVFLEVFGSLKQRVL 338
            |.. ...::..|..| |.:.|:| :......:|.:.|:.|.   |..:::|.............|
plant   244 PEDKDYELENSKTEPDESVLKWLGNRPAKSVVYVAFGTLVA---LSEKQMKEIAMAISQTGYHFL 305

  Fly   339 WKFEDESLPNLPANV----------KVQSWLPQGDILAHPNVKVFIAHGGLFGTQEAVYNGVPIL 393
            |...:.....||:..          .|..|:||.::|||.::..|::|.|...|.||:..|||::
plant   306 WSVRESERSKLPSGFIEEAEEKDSGLVAKWVPQLEVLAHESIGCFVSHCGWNSTLEALCLGVPMV 370

  Fly   394 GMPVYCDQHQNINQGKSAE--YALGLDYRK-----VTVEELRGLLMELIENPK---YRNNIKKAS 448
            |:|.:.||..|   .|..|  :.:|:..|.     .:.||:...::|::|..:   .|.|::|..
plant   371 GVPQWTDQPTN---AKFIEDVWKIGVRVRTDGEGLSSKEEIARCIVEVMEGERGKEIRKNVEKLK 432

  Fly   449 RIFRD 453
            .:.|:
plant   433 VLARE 437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt49B1NP_611563.1 egt 7..513 CDD:223071 62/265 (23%)
UDPGT 38..515 CDD:278624 62/265 (23%)
AT2G31790NP_180738.1 Glycosyltransferase_GTB_type 3..454 CDD:299143 62/265 (23%)
YjiC 6..454 CDD:224732 62/265 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.