DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt49B1 and AT2G23210

DIOPT Version :9

Sequence 1:NP_611563.1 Gene:Ugt49B1 / 37420 FlyBaseID:FBgn0027073 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001318272.1 Gene:AT2G23210 / 816853 AraportID:AT2G23210 Length:287 Species:Arabidopsis thaliana


Alignment Length:114 Identity:24/114 - (21%)
Similarity:37/114 - (32%) Gaps:48/114 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   249 ELERNISAILLNSYMPLAS--------SRPMAYNMIPVGGLHIQPPKALPEHLQKFLDGATHGAI 305
            |..:::..:|.||:..|.|        .:|    :||:|.|  ..|..|.....|.|||      
plant   193 ECLKDVKWVLANSFYELESVIIESMFDLKP----IIPIGPL--VSPFLLGADEDKILDG------ 245

  Fly   306 YFSLGSQVRSADLPPEKLKVFLEVFGSLKQRVLWKFEDESLPNLPANVK 354
                    :|.|                    :||.:|..:..|...|:
plant   246 --------KSLD--------------------MWKADDYCMEWLDKQVR 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt49B1NP_611563.1 egt 7..513 CDD:223071 24/114 (21%)
UDPGT 38..515 CDD:278624 24/114 (21%)
AT2G23210NP_001318272.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.