DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt49B1 and AT2G18560

DIOPT Version :9

Sequence 1:NP_611563.1 Gene:Ugt49B1 / 37420 FlyBaseID:FBgn0027073 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_179446.2 Gene:AT2G18560 / 816371 AraportID:AT2G18560 Length:380 Species:Arabidopsis thaliana


Alignment Length:385 Identity:87/385 - (22%)
Similarity:145/385 - (37%) Gaps:105/385 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   163 QIPTITI-STFGNANHLSQLFGVVSPWSYVP-HA-------YMPYTDRMTLWERIGNVAMSAAED 218
            |.||:.| ..||.|.......||.|.:.|:| ||       |:|..|::...|.:.         
plant    17 QKPTVMIVDFFGTALLSITDVGVTSKYVYIPSHAWFLALIVYLPVLDKVMEGEYVD--------- 72

  Fly   219 LVREFSYYPG---------QDAVLKKHFSKLLDRVPTIKELERNISAILLNSYMPLAS------- 267
             ::|....||         .|.:|.:...:..|.|....|:..: ..:|:|::..|..       
plant    73 -IKEPMKIPGCKPVGPKELLDTMLDRSDQQYRDCVQIGLEIPMS-DGVLVNTWGELQGKTLAALR 135

  Fly   268 -----SRPMAYNMIPVG-----GLHIQPPKALPEHLQKFLDGATHGAIYFSLGSQVRSADLPPEK 322
                 :|.:...:.|:|     .:.|:.|.:..|.|.|   ......:|..|||   ...|..|:
plant   136 EDIDLNRVIKVPVYPIGPIVRTNVLIEKPNSTFEWLDK---QEERSVVYVCLGS---GGTLSFEQ 194

  Fly   323 LKVFLEVFGSLK---QRVLW-------------KFEDESLPNLP---------ANVKVQSWLPQG 362
            .   :|:...|:   |..||             |.:|:....||         ..:.|..|.||.
plant   195 T---MELAWGLELSCQSFLWVLRKPPSYLGASSKDDDQVSDGLPEGFLDRTRGVGLVVTQWAPQV 256

  Fly   363 DILAHPNVKVFIAHGGLFGTQEAVYNGVPILGMPVYCDQHQNINQGKSAEYALGL------DYRK 421
            :||:|.::..|::|.|.....|::..||||:..|:|.:|..|... .:.|..:.:      ..:.
plant   257 EILSHRSIGGFLSHCGWSSVLESLTKGVPIIAWPLYAEQWMNATL-LTEEIGMAIRTSELPSKKV 320

  Fly   422 VTVEELRGLLMELI-ENPKYRNNIK-KAS--RIFRDRPLGAMDTAIYWINYVIEHRGAPH 477
            ::.||:..|:.::: |..|....|| ||.  |:..:|.         |     .|.|:.|
plant   321 ISREEVASLVKKIVAEEDKEGRKIKTKAEEVRVSSERA---------W-----THGGSSH 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt49B1NP_611563.1 egt 7..513 CDD:223071 87/385 (23%)
UDPGT 38..515 CDD:278624 87/385 (23%)
AT2G18560NP_179446.2 Glycosyltransferase_GTB_type 1..380 CDD:299143 87/385 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.