DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KCNA6 and Task6

DIOPT Version :10

Sequence 1:NP_002226.1 Gene:KCNA6 / 3742 HGNCID:6225 Length:529 Species:Homo sapiens
Sequence 2:NP_650300.2 Gene:Task6 / 41671 FlyBaseID:FBgn0038165 Length:408 Species:Drosophila melanogaster


Alignment Length:36 Identity:17/36 - (47%)
Similarity:23/36 - (63%) Gaps:0/36 - (0%)


- Green bases have known domain annotations that are detailed below.


Human   412 AFWWAVVTMTTVGYGDMYPMTVGGKIVGSLCAIAGV 447
            ||::|...:||:|||...|.|||||:.....||.|:
  Fly    83 AFYYATTVLTTIGYGHSTPSTVGGKLFTMCYAIVGI 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KCNA6NP_002226.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..33
BTB_POZ_KCNA6 41..170 CDD:349714
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 210..233
Ion_trans 259..468 CDD:459842 17/36 (47%)
S4-S5 linker. /evidence=ECO:0000250|UniProtKB:P63142 360..373
Selectivity filter. /evidence=ECO:0000250|UniProtKB:P63142 422..427 3/4 (75%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 488..513
PDZ-binding. /evidence=ECO:0000255 527..529
Task6NP_650300.2 Ion_trans_2 <78..132 CDD:462301 17/36 (47%)
Ion_trans_2 165..243 CDD:462301
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.