DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KCNA6 and RpL37-1

DIOPT Version :10

Sequence 1:NP_002226.1 Gene:KCNA6 / 3742 HGNCID:6225 Length:529 Species:Homo sapiens
Sequence 2:NP_573005.1 Gene:RpL37-1 / 32446 FlyBaseID:FBgn0030616 Length:93 Species:Drosophila melanogaster


Alignment Length:61 Identity:16/61 - (26%)
Similarity:21/61 - (34%) Gaps:15/61 - (24%)


- Green bases have known domain annotations that are detailed below.


Human   478 THVTCGQPAPDLRATD----------NGLGKPDFPEANRER-----RPSYLPTPHRAYAEK 523
            |...||.||..||:.:          .|.|:....:..|.|     |......|.:|.|.|
  Fly    33 TCAQCGYPAAKLRSYNWSVKAKRRKTTGTGRMQHLKVVRRRFRNGFREGTQAKPKKAVASK 93

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KCNA6NP_002226.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..33
BTB_POZ_KCNA6 41..170 CDD:349714
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 210..233
Ion_trans 259..468 CDD:459842
S4-S5 linker. /evidence=ECO:0000250|UniProtKB:P63142 360..373
Selectivity filter. /evidence=ECO:0000250|UniProtKB:P63142 422..427
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 488..513 7/39 (18%)
PDZ-binding. /evidence=ECO:0000255 527..529
RpL37-1NP_573005.1 PTZ00073 1..91 CDD:240257 14/57 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.