DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KCNA6 and Ork1

DIOPT Version :10

Sequence 1:NP_002226.1 Gene:KCNA6 / 3742 HGNCID:6225 Length:529 Species:Homo sapiens
Sequence 2:NP_001285097.1 Gene:Ork1 / 32020 FlyBaseID:FBgn0017561 Length:1019 Species:Drosophila melanogaster


Alignment Length:148 Identity:27/148 - (18%)
Similarity:53/148 - (35%) Gaps:60/148 - (40%)


- Green bases have known domain annotations that are detailed below.


Human   378 LLIFFLFIGVILFSSAVYF-----------AE--------------------------------- 398
            :|:...:|..::|.:|:|:           ||                                 
  Fly     7 ILLLIFYISYLMFGAAIYYHIEHGEEKISRAEQRKAQIAINEYLLEELGDKNTTTQDEILQRISD 71

Human   399 -ADDDDSLFPSIPD---------AFWWAVVTMTTVGYGDMYPMTVGGKIVGSLCAIAGVLTIALP 453
             .|...:|.|:..|         ||::|....:|||||::.|.|..|:::....::.|:     |
  Fly    72 YCDKPVTLPPTYDDTPYTWTFYHAFFFAFTVCSTVGYGNISPTTFAGRMIMIAYSVIGI-----P 131

Human   454 V-PVIVSNFNYFYHRETE 470
            | .::.:....::.|..|
  Fly   132 VNGILFAGLGEYFGRTFE 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KCNA6NP_002226.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..33
BTB_POZ_KCNA6 41..170 CDD:349714
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 210..233
Ion_trans 259..468 CDD:459842 25/144 (17%)
S4-S5 linker. /evidence=ECO:0000250|UniProtKB:P63142 360..373
Selectivity filter. /evidence=ECO:0000250|UniProtKB:P63142 422..427 4/4 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 488..513
PDZ-binding. /evidence=ECO:0000255 527..529
Ork1NP_001285097.1 Ion_trans_2 83..144 CDD:462301 15/65 (23%)
Ion_trans_2 185..266 CDD:462301
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.