DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyg and PGSIP2

DIOPT Version :9

Sequence 1:NP_001286666.1 Gene:Gyg / 37419 FlyBaseID:FBgn0265191 Length:699 Species:Drosophila melanogaster
Sequence 2:NP_177838.2 Gene:PGSIP2 / 844049 AraportID:AT1G77130 Length:618 Species:Arabidopsis thaliana


Alignment Length:287 Identity:76/287 - (26%)
Similarity:124/287 - (43%) Gaps:68/287 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KFAWVT-LTTNDTYSLGALVLAHSLKRAKTAHQLAVLVTPNVSQ-------------AMRDRLKE 53
            |.|:.| |.:...|..||:..|.|::.:.:...|.:||...:|:             .|..|::.
plant   284 KEAYATILHSAQFYVCGAIAAAQSIRMSGSTRDLVILVDETISEYHKSGLVAAGWKIQMFQRIRN 348

  Fly    54 ---VYNVVQEVNVLDSQDAANLALLSRPELGVTFTKLHCWRLVQFEKCVFLDADTLVLQNCDELF 115
               |.|...|.|                     ::|...|:|.::.|.:|:|||.|:|:|.|.||
plant   349 PNAVPNAYNEWN---------------------YSKFRLWQLTEYSKIIFIDADMLILRNIDFLF 392

  Fly   116 EREELSAAPDVSWPDCFNSGVFVFKPSVDTFAQITEFAVKNGSFDGGDQGLLNQFFADWSTADIK 180
            |..|:||..:.:  ..||||:.|.:||..||..:.:...:..|::|||||.||:.|..|..  |.
plant   393 EFPEISATGNNA--TLFNSGLMVVEPSNSTFQLLMDNINEVVSYNGGDQGYLNEIFTWWHR--IP 453

  Fly   181 KHLPFVYNVTAYASYCYLPAFKQFRDK--------IKILHFAGKLKPWLI--QFNSETKVASVSS 235
            ||:.|:.:......    |..|:.:..        :.:||:.|..||||.  .::....| .:..
plant   454 KHMNFLKHFWEGDE----PEIKKMKTSLFGADPPILYVLHYLGYNKPWLCFRDYDCNWNV-DIFQ 513

  Fly   236 EYAHAQDLIQLWWNI----------FC 252
            |:| :.:..:.||.:          ||
plant   514 EFA-SDEAHKTWWRVHDAMPENLHKFC 539

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GygNP_001286666.1 GT8_Glycogenin 4..253 CDD:133018 75/286 (26%)
RfaJ <94..251 CDD:224359 52/176 (30%)
PGSIP2NP_177838.2 GT8_Glycogenin 285..531 CDD:133018 73/276 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 82 1.000 Domainoid score I2911
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1424146at2759
OrthoFinder 1 1.000 - - FOG0001116
OrthoInspector 1 1.000 - - otm3097
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11183
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X386
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
88.020

Return to query results.
Submit another query.