DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyg and GolS4

DIOPT Version :9

Sequence 1:NP_001286666.1 Gene:Gyg / 37419 FlyBaseID:FBgn0265191 Length:699 Species:Drosophila melanogaster
Sequence 2:NP_176250.1 Gene:GolS4 / 842342 AraportID:AT1G60470 Length:334 Species:Arabidopsis thaliana


Alignment Length:332 Identity:78/332 - (23%)
Similarity:145/332 - (43%) Gaps:65/332 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 AWVT-LTTNDTYSLGALVLAHSLKRAKTAHQLAVLVTPNVSQAMRDRLKEVYNVVQEVNVLDSQD 68
            |:|| |..|..|..|.:.||..|::.|:|:.|.|.:.|:|.:..|:.|:....||:|:..:...|
plant    24 AYVTFLAGNGDYVKGVVGLAKGLRKVKSAYPLVVAMLPDVPEEHREILRSQGCVVREIEPVYPPD 88

  Fly    69 AANLALLSRPELGVTFTKLHCWRLVQFEKCVFLDADTLVLQNCDELFEREE-------------- 119
              |....:.....:.::||..|...::.|.::||||..|..|.|.||:..:              
plant    89 --NQVEFAMAYYVLNYSKLRIWNFEEYSKMIYLDADIQVFDNIDHLFDLSDAYFYAVMDCFCEKT 151

  Fly   120 -----------LSAAPD-VSWPD---------CFNSGVFVFKPSVDTFAQITEFAVKNGSFDGGD 163
                       ....|: |:||:         .||:|:|||:||..|:..:.:...........:
plant   152 WSHSLQYSIGYCQQCPEKVTWPEDMESPPPPLYFNAGMFVFEPSPLTYESLLQTLEITPPSPFAE 216

  Fly   164 QGLLNQFFADWSTADIKKHLPFVYNVTAYASYCYLPAFKQFRDKIKILHF-AGKLKPWLIQFNSE 227
            |..||.||     ..:.|.:|.|||:.....:.: |...:. :|:|::|: |...|||  ::..|
plant   217 QDFLNMFF-----EKVYKPIPLVYNLVLAMLWRH-PENVEL-EKVKVVHYCAAGSKPW--RYTGE 272

  Fly   228 TKVASVSSEYAHAQDLIQLWWNIFCENVIQSLSTEMQTPGNVASDRPAGEMAQGSTTLECLCLNI 292
            .  |::..|  ..:.|:..||:::.:   :||..:.:.|.:          |:.:.|...:..::
plant   273 E--ANMDRE--DIKMLVDKWWDVYND---ESLDFKSKIPAD----------AEETVTKSSILASV 320

  Fly   293 IRTQSEF 299
            :..:..:
plant   321 LEPEMTY 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GygNP_001286666.1 GT8_Glycogenin 4..253 CDD:133018 73/284 (26%)
RfaJ <94..251 CDD:224359 47/192 (24%)
GolS4NP_176250.1 PLN00176 1..334 CDD:215090 78/332 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11183
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X386
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.