DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyg and GolS2

DIOPT Version :9

Sequence 1:NP_001286666.1 Gene:Gyg / 37419 FlyBaseID:FBgn0265191 Length:699 Species:Drosophila melanogaster
Sequence 2:NP_176053.1 Gene:GolS2 / 842114 AraportID:AT1G56600 Length:335 Species:Arabidopsis thaliana


Alignment Length:299 Identity:78/299 - (26%)
Similarity:129/299 - (43%) Gaps:78/299 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KFAWVT-LTTNDTYSLGALVLAHSLKRAKTAHQLAVLVTPNVSQAMRDRLKEVYNVVQEVN-VLD 65
            |.|:|| |.....|..|.:.||..|::||:.:.|.|.|.|:|.:..|.:|.:...||:|:. |..
plant    21 KRAYVTFLAGTGDYVKGVVGLAKGLRKAKSKYPLVVAVLPDVPEDHRKQLVDQGCVVKEIEPVYP 85

  Fly    66 SQDAANLALLSRPELGVTFTKLHCWRLVQFEKCVFLDADTLVLQNCDELFEREE----------- 119
            .::....|:   ....:.::||..|..|::.|.::||.|..|..|.|.||:...           
plant    86 PENQTEFAM---AYYVINYSKLRIWEFVEYNKMIYLDGDIQVFDNIDHLFDLPNGQFYAVMDCFC 147

  Fly   120 --------------LSAAPD-VSWPDC---------FNSGVFVFKPSVDTFAQITE--------- 151
                          ....|| |:||:.         ||:|:||::|::.|:..:.|         
plant   148 EKTWSHSPQYKIGYCQQCPDKVTWPEAKLGPKPPLYFNAGMFVYEPNLSTYHNLLETVKIVPPTL 212

  Fly   152 FAVKNGSFDGGDQGLLNQFFADWSTADIKKHLPFVYNVTAYASYCYLPAFKQFRDKIKILHF-AG 215
            ||         :|..||.:|     .||.|.:|.|||:.....:.:....:  .|::|::|: |.
plant   213 FA---------EQDFLNMYF-----KDIYKPIPPVYNLVLAMLWRHPENIE--LDQVKVVHYCAA 261

  Fly   216 KLKPWLIQFNSETKVASVSSEYAHAQD---LIQLWWNIF 251
            ..|||  :|..|       .|....:|   |::.||:|:
plant   262 GAKPW--RFTGE-------EENMDREDIKMLVKKWWDIY 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GygNP_001286666.1 GT8_Glycogenin 4..253 CDD:133018 77/298 (26%)
RfaJ <94..251 CDD:224359 49/204 (24%)
GolS2NP_176053.1 PLN00176 1..335 CDD:215090 78/299 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11183
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X386
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.