DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyg and GolS3

DIOPT Version :9

Sequence 1:NP_001286666.1 Gene:Gyg / 37419 FlyBaseID:FBgn0265191 Length:699 Species:Drosophila melanogaster
Sequence 2:NP_172406.1 Gene:GolS3 / 837457 AraportID:AT1G09350 Length:334 Species:Arabidopsis thaliana


Alignment Length:295 Identity:74/295 - (25%)
Similarity:128/295 - (43%) Gaps:70/295 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KFAWVT-LTTNDTYSLGALVLAHSLKRAKTAHQLAVLVTPNVSQAMRDRLKEVYNVVQEVNVLDS 66
            |.|:|| |.....|..|.:.||..|::.|:.:.|.|.|.|:|....|.:|.:...|::|:..:..
plant    15 KRAYVTFLAGTGDYVKGVVGLAKGLRKTKSKYPLVVAVLPDVPADHRRQLLDQGCVIKEIQPVYP 79

  Fly    67 QDAANLALLSRPELGVTFTKLHCWRLVQFEKCVFLDADTLVLQNCDELFEREE------------ 119
            .|  |....:.....:.::||..|:.|::.|.::||.|..|.:|.|.||:..:            
plant    80 PD--NQTQFAMAYYVLNYSKLRIWKFVEYSKLIYLDGDIQVFENIDHLFDLPDGNFYAVKDCFCE 142

  Fly   120 -------------LSAAPD-VSWPDC---------FNSGVFVFKPSVDTFAQI---------TEF 152
                         ....|| |:||:.         ||:|:||::||:.|:..:         |.|
plant   143 KTWSHTPQYKIGYCQQCPDKVTWPESELGPKPPLYFNAGMFVYEPSLPTYYNLLETLKVVPPTPF 207

  Fly   153 AVKNGSFDGGDQGLLNQFFADWSTADIKKHLPFVYNVTAYASYCYLPAFKQFRDKIKILHF-AGK 216
            |         :|..||.:|     .||.|.:|.|||:.....:.:....:  .::.|::|: |..
plant   208 A---------EQDFLNMYF-----KDIYKPIPPVYNLVLAMLWRHPENIE--LNEAKVVHYCAAG 256

  Fly   217 LKPWLIQFNSETKVASVSSEYAHAQDLIQLWWNIF 251
            .|||  :|..:    ..:.|....:.|::.||:|:
plant   257 AKPW--RFTGQ----EGNMEREDIKMLVEKWWDIY 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GygNP_001286666.1 GT8_Glycogenin 4..253 CDD:133018 73/294 (25%)
RfaJ <94..251 CDD:224359 47/201 (23%)
GolS3NP_172406.1 PLN00176 1..334 CDD:215090 74/295 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11183
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X386
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.010

Return to query results.
Submit another query.