DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyg and PGSIP5

DIOPT Version :9

Sequence 1:NP_001286666.1 Gene:Gyg / 37419 FlyBaseID:FBgn0265191 Length:699 Species:Drosophila melanogaster
Sequence 2:NP_172373.3 Gene:PGSIP5 / 837420 AraportID:AT1G08990 Length:566 Species:Arabidopsis thaliana


Alignment Length:284 Identity:71/284 - (25%)
Similarity:127/284 - (44%) Gaps:82/284 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KFAWVTLT-TNDTYSLGALVLAHSLKRAKTAHQLAVLVTPNVSQ-----------AMR--DRLKE 53
            :.|:|||. :::.|..||:.||.|::::.:...:.:|...:::.           .:|  :|::.
plant   277 RVAYVTLLHSSEVYVCGAIALAQSIRQSGSTKDMILLHDDSITNISLIGLSLAGWKLRRVERIRS 341

  Fly    54 VYNVVQEVNVLDSQDAANLALLSRPELGVTFTKLHCWRLVQFEKCVFLDADTLVLQNCDELFERE 118
            .::..:..|..:                  ::||..|::..::|.||:|||.::::|.|.||...
plant   342 PFSKKRSYNEWN------------------YSKLRVWQVTDYDKLVFIDADFIIVKNIDYLFSYP 388

  Fly   119 ELSAAPDVSWPDCFNSGVFVFKPSVDTFAQITEFAVKNGSFDGGDQGLLNQFFADW--------- 174
            :||||.:..  ..|||||.|.:||...|..:...:.|.||::|||||.||::|..|         
plant   389 QLSAAGNNK--VLFNSGVMVLEPSACLFEDLMLKSFKIGSYNGGDQGFLNEYFVWWHRLSKRLNT 451

  Fly   175 -------STADIKKHLPFVYNVTAYASYCYLPAFKQFRDKIKILHFAGKLKPWL----IQFNSET 228
                   |..|..::||                     :.::.:|:.| ||||.    ...|.:.
plant   452 MKYFGDESRHDKARNLP---------------------ENLEGIHYLG-LKPWRCYRDYDCNWDL 494

  Fly   229 KVASV-SSEYAHAQDLIQLWWNIF 251
            |...| :||..||:     ||.::
plant   495 KTRRVYASESVHAR-----WWKVY 513

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GygNP_001286666.1 GT8_Glycogenin 4..253 CDD:133018 71/283 (25%)
RfaJ <94..251 CDD:224359 54/177 (31%)
PGSIP5NP_172373.3 GT8_Glycogenin 278..516 CDD:133018 71/283 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 82 1.000 Domainoid score I2911
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1424146at2759
OrthoFinder 1 1.000 - - FOG0001116
OrthoInspector 1 1.000 - - otm3097
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11183
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X386
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.020

Return to query results.
Submit another query.