DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyg and PGSIP6

DIOPT Version :9

Sequence 1:NP_001286666.1 Gene:Gyg / 37419 FlyBaseID:FBgn0265191 Length:699 Species:Drosophila melanogaster
Sequence 2:NP_197349.2 Gene:PGSIP6 / 831966 AraportID:AT5G18480 Length:537 Species:Arabidopsis thaliana


Alignment Length:246 Identity:71/246 - (28%)
Similarity:112/246 - (45%) Gaps:44/246 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SKFAWVTLTTNDTYSLGALVLAHSLKRAKTAHQLAVLVTPNVSQAMRDRLKEVYNVVQEVNVLDS 66
            ||.|:|||...|.:.||..||..|::...:...:..||:..||...:..||           .|.
plant    29 SKVAYVTLLYGDEFLLGVRVLGKSIRDTGSTKDMVALVSDGVSDYSKKLLK-----------ADG 82

  Fly    67 QDAANLALLSRPE-------LGVTFTKLHCWRLVQFEKCVFLDADTLVLQNCDELFEREELSAAP 124
            .....::||:.|.       .|| :|||..:.:..::|.|:|||||:|::|.::||:..:..|  
plant    83 WKVEKISLLANPNQVHPTRFWGV-YTKLKIFNMTDYKKVVYLDADTIVVKNIEDLFKCSKFCA-- 144

  Fly   125 DVSWPDCFNSGVFVFKPSVDTFAQITEFAVKNGSFDGGDQGLLNQFFADWSTADI---------- 179
            ::...:..||||.|.:||...|..:........|:.|||||.||.::.|:..|.:          
plant   145 NLKHSERLNSGVMVVEPSEALFNDMMRKVKTLSSYTGGDQGFLNSYYPDFPNARVFDPSVTPEVL 209

  Fly   180 -------KKHLPFVYNVTAYASYCYLPAFKQFRD--KIKILHFA-GKLKPW 220
                   .:.|..:||...   ..|:.|.|...|  |:.::|:. |.||||
plant   210 KTRPVPAMERLSTLYNADV---GLYMLANKWMVDDSKLHVIHYTLGPLKPW 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GygNP_001286666.1 GT8_Glycogenin 4..253 CDD:133018 69/244 (28%)
RfaJ <94..251 CDD:224359 44/147 (30%)
PGSIP6NP_197349.2 GT8_Glycogenin 31..275 CDD:133018 69/244 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1424146at2759
OrthoFinder 1 1.000 - - FOG0001116
OrthoInspector 1 1.000 - - otm3097
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11183
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X386
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
77.020

Return to query results.
Submit another query.