DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyg and PGSIP3

DIOPT Version :9

Sequence 1:NP_001286666.1 Gene:Gyg / 37419 FlyBaseID:FBgn0265191 Length:699 Species:Drosophila melanogaster
Sequence 2:NP_001154284.1 Gene:PGSIP3 / 829469 AraportID:AT4G33330 Length:626 Species:Arabidopsis thaliana


Alignment Length:287 Identity:76/287 - (26%)
Similarity:123/287 - (42%) Gaps:74/287 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 AWVT-LTTNDTYSLGALVLAHSLKRAKTAHQLAVLVTPNVS----QAMRDRLKEVYNVVQEVNVL 64
            |:|| |.::::|..||:.||.||.:..|...|.:|...::|    :|:.....::..:::..|.|
plant   302 AYVTVLHSSESYVCGAITLAQSLLQTNTKRDLILLHDDSISITKLRALAAAGWKLRRIIRIRNPL 366

  Fly    65 DSQDAANLALLSRPELGVTFTKLHCWRLVQFEKCVFLDADTLVLQNCDELFEREELSAAPDVSWP 129
            ..:|:.|         ...::|...|:|..::|.:|:|||.:||:|.|.||...::||..:..| 
plant   367 AEKDSYN---------EYNYSKFRLWQLTDYDKVIFIDADIIVLRNLDLLFHFPQMSATGNDVW- 421

  Fly   130 DCFNSGVFVFKPSVDTFAQITEFAVKNGSFDGGDQGLLNQFFADW------------------ST 176
             .:|||:.|.:||..||..|.....:..|::|||||.||:.|..|                  ..
plant   422 -IYNSGIMVIEPSNCTFTTIMSQRSEIVSYNGGDQGYLNEIFVWWHRLPRRVNFLKNFWSNTTKE 485

  Fly   177 ADIKKHL-----PFVYNVTAYASYCYLPAFKQFRDKIKILHFAGKLKPWLIQFNSETKVASVSSE 236
            .:||.:|     |.||.|                      |:.| .||||...:.:... .|..:
plant   486 RNIKNNLFAAEPPQVYAV----------------------HYLG-WKPWLCYRDYDCNY-DVDEQ 526

  Fly   237 YAHAQDLIQL-WWNI----------FC 252
            ..:|.|...: ||.:          ||
plant   527 LVYASDAAHVRWWKVHDSMDDALQKFC 553

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GygNP_001286666.1 GT8_Glycogenin 4..253 CDD:133018 76/287 (26%)
RfaJ <94..251 CDD:224359 51/190 (27%)
PGSIP3NP_001154284.1 GT8_Glycogenin 301..545 CDD:133018 74/277 (27%)
RfaJ 313..>511 CDD:224359 62/231 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 82 1.000 Domainoid score I2911
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1424146at2759
OrthoFinder 1 1.000 - - FOG0001116
OrthoInspector 1 1.000 - - otm3097
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11183
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X386
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.020

Return to query results.
Submit another query.