DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyg and PGSIP1

DIOPT Version :9

Sequence 1:NP_001286666.1 Gene:Gyg / 37419 FlyBaseID:FBgn0265191 Length:699 Species:Drosophila melanogaster
Sequence 2:NP_001030722.1 Gene:PGSIP1 / 821397 AraportID:AT3G18660 Length:659 Species:Arabidopsis thaliana


Alignment Length:288 Identity:82/288 - (28%)
Similarity:125/288 - (43%) Gaps:75/288 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 AWVT-LTTNDTYSLGALVLAHSLKRAKTAHQLAVLVTPNVSQAMRDRLKEV---YNVVQEV-NVL 64
            |:.| |.:...|..||:..|.|::::.:...|.:||..|:|...|..|:..   ...:|.: |..
plant   323 AYATILHSAHVYVCGAIAAAQSIRQSGSTRDLVILVDDNISGYHRSGLEAAGWQIRTIQRIRNPK 387

  Fly    65 DSQDAANLALLSRPELGVTFTKLHCWRLVQFEKCVFLDADTLVLQNCDELFEREELSAAPDVSWP 129
            ..:||.|         ...::|...|:|..::|.:|:|||.|:|:|.|.||...|:||..:..  
plant   388 AEKDAYN---------EWNYSKFRLWQLTDYDKIIFIDADLLILRNIDFLFSMPEISATGNNG-- 441

  Fly   130 DCFNSGVFVFKPSVDTFAQITEFAVKNGSFDGGDQGLLNQFFADWSTADIKKHLPFVYNVTAYAS 194
            ..|||||.|.:|...||..:.|...:..|::|||||.||:.|..|..  |.||:.|:        
plant   442 TLFNSGVMVIEPCNCTFQLLMEHINEIESYNGGDQGYLNEVFTWWHR--IPKHMNFL-------- 496

  Fly   195 YCYLPAFKQF---------RDK----------IKILHFAGKLKPWL------IQFNSETKVASVS 234
                   |.|         |.|          :.:||:.| :||||      ..|||:..| ..:
plant   497 -------KHFWIGDEDDAKRKKTELFGAEPPVLYVLHYLG-MKPWLCYRDYDCNFNSDIFV-EFA 552

  Fly   235 SEYAHAQDLIQLWWNI----------FC 252
            ::.||.:     ||.:          ||
plant   553 TDIAHRK-----WWMVHDAMPQELHQFC 575

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GygNP_001286666.1 GT8_Glycogenin 4..253 CDD:133018 82/288 (28%)
RfaJ <94..251 CDD:224359 57/191 (30%)
PGSIP1NP_001030722.1 GT8_Glycogenin 322..567 CDD:133018 80/278 (29%)
RfaJ <397..>533 CDD:224359 49/155 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 82 1.000 Domainoid score I2911
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1424146at2759
OrthoFinder 1 1.000 - - FOG0001116
OrthoInspector 1 1.000 - - otm3097
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11183
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X386
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.020

Return to query results.
Submit another query.