DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyg and GolS1

DIOPT Version :9

Sequence 1:NP_001286666.1 Gene:Gyg / 37419 FlyBaseID:FBgn0265191 Length:699 Species:Drosophila melanogaster
Sequence 2:NP_182240.1 Gene:GolS1 / 819331 AraportID:AT2G47180 Length:344 Species:Arabidopsis thaliana


Alignment Length:294 Identity:74/294 - (25%)
Similarity:129/294 - (43%) Gaps:72/294 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 AWVT-LTTNDTYSLGALVLAHSLKRAKTAHQLAVLVTPNVSQAMRDRLKEVYNVVQEVN-VLDSQ 67
            |:|| |..|..|..|.:.||..|::.|:|:.|.|.:.|:|.:..|..|.:...:|:|:. |...:
plant    31 AYVTFLAGNGDYVKGVVGLAKGLRKVKSAYPLVVAMLPDVPEEHRRILVDQGCIVREIEPVYPPE 95

  Fly    68 DAANLALLSRPELGVTFTKLHCWRLVQFEKCVFLDADTLVLQNCDELFEREE------------- 119
            :....|:   ....:.::||..|:.|::.|.::||.|..|.:|.|.||:..:             
plant    96 NQTQFAM---AYYVINYSKLRIWKFVEYSKMIYLDGDIQVYENIDHLFDLPDGYLYAVMDCFCEK 157

  Fly   120 ------------LSAAPD-VSWPDC---------FNSGVFVFKPSVDTFAQI---------TEFA 153
                        ....|| |.||..         ||:|:|:::|:::|:..:         |.||
plant   158 TWSHTPQYKIRYCQQCPDKVQWPKAELGEPPALYFNAGMFLYEPNLETYEDLLRTLKITPPTPFA 222

  Fly   154 VKNGSFDGGDQGLLNQFFADWSTADIKKHLPFVYNVTAYASYCYLPAFKQFRDKIKILHF-AGKL 217
                     :|..||.:|     ..|.|.:|.|||:.....:.: |...:. .|:|::|: |...
plant   223 ---------EQDFLNMYF-----KKIYKPIPLVYNLVLAMLWRH-PENVEL-GKVKVVHYCAAGS 271

  Fly   218 KPWLIQFNSETKVASVSSEYAHAQDLIQLWWNIF 251
            |||    ....|.|::..|  ..:.|::.||:|:
plant   272 KPW----RYTGKEANMERE--DIKMLVKKWWDIY 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GygNP_001286666.1 GT8_Glycogenin 4..253 CDD:133018 74/294 (25%)
RfaJ <94..251 CDD:224359 47/201 (23%)
GolS1NP_182240.1 PLN00176 1..344 CDD:215090 74/294 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11183
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X386
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.010

Return to query results.
Submit another query.