DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyg and PGSIP7

DIOPT Version :9

Sequence 1:NP_001286666.1 Gene:Gyg / 37419 FlyBaseID:FBgn0265191 Length:699 Species:Drosophila melanogaster
Sequence 2:NP_565817.2 Gene:PGSIP7 / 818140 AraportID:AT2G35710 Length:497 Species:Arabidopsis thaliana


Alignment Length:255 Identity:69/255 - (27%)
Similarity:105/255 - (41%) Gaps:58/255 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KFAWVTL----TTND-TYSLGALVLAHSLKRAKTAHQLAVLVTPNVSQAMRDRLKEVYNVVQEVN 62
            |.|:.|:    |..| .:.:...||..||:.......|.|:.:.:|.             ::.|.
plant    62 KNAYATMMYMGTPRDYEFYVATRVLIRSLRSLHVEADLVVIASLDVP-------------LRWVQ 113

  Fly    63 VLDSQDAANLALLSRPE------------LGVTFTKLHCWRLVQFEKCVFLDADTLVLQNCDELF 115
            .|:.:|.|.:..:...:            ..:|..||:.|.|..:::.|.||||.|.|:..||||
plant   114 TLEEEDGAKVVRVENVDNPYRRQTNFNSRFKLTLNKLYAWALSDYDRVVMLDADNLFLKKADELF 178

  Fly   116 EREELSAAPDVSWPDCFNSGVFVFKPSVDTFA-QITEFAVKNGSFDGGDQGLLNQFFAD------ 173
            :.....|.  ...|..|::|:||.:|||:.|. .:.|..|...:.||.|||.|..:|:|      
plant   179 QCGRFCAV--FINPCIFHTGLFVLQPSVEVFKDMLHELQVGRKNPDGADQGFLVSYFSDLLDQPL 241

  Fly   174 ------WSTADIKKHLPFVYNVTAYASYCYLPAFKQFRDKI-----KILHFAGK--LKPW 220
                  .|..:....||..|.:.  |||.||    :.|..|     .::.|.|.  ||||
plant   242 FSPPSNGSVLNGHLRLPLGYQMD--ASYFYL----KLRWNIPCGPNSVITFPGAVWLKPW 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GygNP_001286666.1 GT8_Glycogenin 4..253 CDD:133018 68/254 (27%)
RfaJ <94..251 CDD:224359 48/147 (33%)
PGSIP7NP_565817.2 GT8_Glycogenin 63..315 CDD:133018 68/254 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1424146at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR11183
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.