DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyg and mug136

DIOPT Version :9

Sequence 1:NP_001286666.1 Gene:Gyg / 37419 FlyBaseID:FBgn0265191 Length:699 Species:Drosophila melanogaster
Sequence 2:NP_596297.1 Gene:mug136 / 2541006 PomBaseID:SPBC4C3.08 Length:372 Species:Schizosaccharomyces pombe


Alignment Length:356 Identity:76/356 - (21%)
Similarity:123/356 - (34%) Gaps:141/356 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SKFAWVTL--------------TTNDTYSLGALVLAHSL---KRAKTAHQLAVLVTPNVSQAMRD 49
            ||.|:||:              |..|.|.....:|.|.|   |..|:.:.:.||....:.|...|
pombe    55 SKMAFVTMLTVRAANGENEVENTQQDWYYNSTRLLVHRLVKFKPTKSKYPVVVLAMKGIDQWKLD 119

  Fly    50 RLKEVYNVVQEVNVLDS----QDAANLALLSRPELGVTFTKLHCWRLVQFEKCVFLDADTLVLQN 110
            :|:|...:|:.|:.|.:    .|..::|||. ....:.||||..:.:.::::..|||:|.|.::.
pombe   120 QLQEDGAIVKVVDPLYAHEVVDDVNDIALLD-SRWSMMFTKLRVFEMYEYDRICFLDSDILPIKK 183

  Fly   111 CDELFEREELSAAPD---------------VSW-------------------------------- 128
            .|::|:..:||.:.|               :.|                                
pombe   184 MDKVFDVHQLSYSKDSVLFPPTLFYKPRRSIFWRRFTEEFAAYGLTRDDLYPYVFAAVSDPGMWH 248

  Fly   129 ------PDCFNSGVFVFKPSVDTFAQITEFAVKNGSFDGG---DQGLLNQFFA------------ 172
                  .|.||:|:|||||....:.::...|.....:|..   :|.|||  ||            
pombe   249 ETPPPFKDYFNAGLFVFKPLKAHYKRLMALARFPKLYDNANMMEQSLLN--FAYNSAGAFPWESL 311

  Fly   173 DWSTADI---KKHLPFVYNVTAYASYCYLPAFKQFRDKIKILHFAGKLKPWLIQFNSETKVASVS 234
            ||:...:   |..||:                      :|.:|.    |.|           ...
pombe   312 DWTFNGLWARKNDLPY----------------------LKAVHG----KHW-----------QPE 339

  Fly   235 SEYAHAQDLIQLWWNIFCENVIQSLSTEMQT 265
            ....:.:|..:|||:.|         .||||
pombe   340 GSLGYDEDTSKLWWDAF---------QEMQT 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GygNP_001286666.1 GT8_Glycogenin 4..253 CDD:133018 70/340 (21%)
RfaJ <94..251 CDD:224359 41/227 (18%)
mug136NP_596297.1 Gnt1 1..368 CDD:227884 76/356 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto100499
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11183
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2133
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.040

Return to query results.
Submit another query.