DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyg and gyg-2

DIOPT Version :9

Sequence 1:NP_001286666.1 Gene:Gyg / 37419 FlyBaseID:FBgn0265191 Length:699 Species:Drosophila melanogaster
Sequence 2:NP_507238.1 Gene:gyg-2 / 180119 WormBaseID:WBGene00012020 Length:300 Species:Caenorhabditis elegans


Alignment Length:268 Identity:118/268 - (44%)
Similarity:167/268 - (62%) Gaps:12/268 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 AWVTLTTNDTYSLGALVLAHSLKRAKTAHQLAVLVTPNVSQAMRDRLKEVYNVVQEVNVLDSQDA 69
            ||:||.|||.|:.|||.|.:||..:.|..::..|:|..:|.::|::|...::.|..|::.:|.|:
 Worm     4 AWITLATNDRYAQGALTLLNSLHASGTTRRIHCLITNEISNSVREKLVNKFDEVTVVDIFNSNDS 68

  Fly    70 ANLALLSRPELGVTFTKLHCWRLVQFEKCVFLDADTLVLQNCDELFEREELSAAPDVSWPDCFNS 134
            .||:|:.||:|||||||.|||||.|:.|.|||||||::::|.||||||.:.|||.|:.|||.|||
 Worm    69 ENLSLIGRPDLGVTFTKFHCWRLTQYSKAVFLDADTMIIRNSDELFERPDFSAAADIGWPDMFNS 133

  Fly   135 GVFVFKPSVDTFAQITEFAVKNGSFDGGDQGLLNQFFADWSTADIKKHLPFVYNVTAYASYCYLP 199
            |||||.||:..:..:...|..:||||||||||||::|::|........|||:||:||...|.|..
 Worm   134 GVFVFTPSLTVYRALLSLATSSGSFDGGDQGLLNEYFSNWRDLPSAHRLPFIYNMTAGEFYSYPA 198

  Fly   200 AFKQFRDKIKILHFAGKLKPWLIQFNSETKVASVSSEYAHAQDLIQLWWNIFCENVIQSLSTEMQ 264
            |::::..:.||:||.|..|||    ||..     |....|..:..|.|.:...::   |.|:|..
 Worm   199 AYRKYGAQTKIVHFIGAQKPW----NSPP-----SDSGLHKNEHYQQWHSFSLQS---SSSSEAP 251

  Fly   265 TPGNVASD 272
            ....|..|
 Worm   252 AAPKVEDD 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GygNP_001286666.1 GT8_Glycogenin 4..253 CDD:133018 113/247 (46%)
RfaJ <94..251 CDD:224359 72/156 (46%)
gyg-2NP_507238.1 GT8_Glycogenin 3..238 CDD:133018 112/242 (46%)
RfaJ 6..>238 CDD:224359 110/240 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 295 1.000 Inparanoid score I1664
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1424146at2759
OrthoFinder 1 1.000 - - FOG0001116
OrthoInspector 1 1.000 - - otm14505
orthoMCL 1 0.900 - - OOG6_101901
Panther 1 1.100 - - O PTHR11183
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X386
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.970

Return to query results.
Submit another query.