| Sequence 1: | NP_611561.1 | Gene: | Lapsyn / 37418 | FlyBaseID: | FBgn0034602 | Length: | 343 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_003256.1 | Gene: | TLR3 / 7098 | HGNCID: | 11849 | Length: | 904 | Species: | Homo sapiens |
| Alignment Length: | 300 | Identity: | 71/300 - (23%) |
|---|---|---|---|
| Similarity: | 125/300 - (41%) | Gaps: | 81/300 - (27%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 21 GFIIQSEVRKCTYGH--IDKLLRIRCYDLDLKEVPQNLKSSVEVLDLSHNRIRKLKTSSFQRYTD 83
Fly 84 ------------------------IKFLMLYDNMILSVEVGTFEPLTSLQE-------------- 110
Fly 111 ----------IDLSNNGLTTIPL-ELFQLPRLRNLYIDSNELTSLNLQALEKPIRAPLEYLNVAG 164
Fly 165 CELQELPD-----LGILPKLWQLNASMNPLQNFRID-SLANMCHLQVIDLTKSQLSQCGCQQVTN 223
Fly 224 HLMMLGASPKFVPVCLEALDIRECPLPYN--RTIHSPTFA 261 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Lapsyn | NP_611561.1 | leucine-rich repeat | 39..59 | CDD:275380 | 6/19 (32%) |
| LRR_8 | 58..118 | CDD:290566 | 23/107 (21%) | ||
| leucine-rich repeat | 60..83 | CDD:275380 | 10/22 (45%) | ||
| leucine-rich repeat | 84..107 | CDD:275380 | 6/22 (27%) | ||
| LRR_RI | <94..>249 | CDD:238064 | 39/185 (21%) | ||
| LRR_8 | 106..167 | CDD:290566 | 19/85 (22%) | ||
| LRR_4 | 106..145 | CDD:289563 | 15/63 (24%) | ||
| leucine-rich repeat | 108..130 | CDD:275380 | 11/46 (24%) | ||
| leucine-rich repeat | 131..154 | CDD:275380 | 5/22 (23%) | ||
| leucine-rich repeat | 157..178 | CDD:275380 | 5/25 (20%) | ||
| leucine-rich repeat | 179..202 | CDD:275380 | 6/23 (26%) | ||
| TLR3 | NP_003256.1 | LRRNT | 28..50 | CDD:396168 | 9/27 (33%) |
| leucine-rich repeat | 33..52 | CDD:275380 | 7/24 (29%) | ||
| LRR 1 | 52..73 | 8/20 (40%) | |||
| leucine-rich repeat | 53..76 | CDD:275380 | 10/22 (45%) | ||
| PLN00113 | 72..>542 | CDD:215061 | 49/239 (21%) | ||
| LRR 2 | 76..97 | 0/20 (0%) | |||
| leucine-rich repeat | 77..100 | CDD:275380 | 0/22 (0%) | ||
| LRR 3 | 100..121 | 6/20 (30%) | |||
| leucine-rich repeat | 101..124 | CDD:275380 | 6/22 (27%) | ||
| LRR 4 | 124..145 | 2/20 (10%) | |||
| leucine-rich repeat | 125..148 | CDD:275380 | 2/22 (9%) | ||
| LRR 5 | 148..168 | 7/19 (37%) | |||
| leucine-rich repeat | 149..198 | CDD:275380 | 14/48 (29%) | ||
| LRR 6 | 172..193 | 5/20 (25%) | |||
| LRR 7 | 198..219 | 3/20 (15%) | |||
| leucine-rich repeat | 199..249 | CDD:275380 | 11/50 (22%) | ||
| LRR 8 | 222..244 | 4/21 (19%) | |||
| LRR 9 | 249..270 | 6/26 (23%) | |||
| leucine-rich repeat | 250..275 | CDD:275380 | 9/39 (23%) | ||
| LRR 10 | 275..296 | 4/20 (20%) | |||
| leucine-rich repeat | 276..299 | CDD:275380 | 4/19 (21%) | ||
| LRR 11 | 299..320 | ||||
| leucine-rich repeat | 300..321 | CDD:275380 | |||
| LRR 12 | 323..344 | ||||
| LRR 13 | 356..377 | ||||
| leucine-rich repeat | 357..380 | CDD:275380 | |||
| LRR 14 | 380..400 | ||||
| leucine-rich repeat | 381..406 | CDD:275380 | |||
| LRR 15 | 408..429 | ||||
| leucine-rich repeat | 409..432 | CDD:275380 | |||
| LRR 16 | 432..454 | ||||
| leucine-rich repeat | 433..457 | CDD:275380 | |||
| leucine-rich repeat | 458..481 | CDD:275380 | |||
| LRR 17 | 465..486 | ||||
| leucine-rich repeat | 482..507 | CDD:275380 | |||
| LRR 18 | 507..528 | ||||
| leucine-rich repeat | 508..531 | CDD:275380 | |||
| LRR 19 | 531..552 | ||||
| leucine-rich repeat | 532..563 | CDD:275380 | |||
| LRR_8 | 562..622 | CDD:404697 | |||
| LRR 20 | 563..584 | ||||
| leucine-rich repeat | 564..585 | CDD:275380 | |||
| LRR 21 | 587..608 | ||||
| leucine-rich repeat | 588..611 | CDD:275380 | |||
| LRR 22 | 611..632 | ||||
| leucine-rich repeat | 612..630 | CDD:275380 | |||
| leucine-rich repeat | 637..659 | CDD:275380 | |||
| LRRCT | 645..697 | CDD:214507 | |||
| Tlr3_TMD | 698..730 | CDD:407816 | |||
| TIR | 755..900 | CDD:214587 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 0 | 0.000 | |||||