DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lapsyn and ISLR2

DIOPT Version :10

Sequence 1:NP_611561.1 Gene:Lapsyn / 37418 FlyBaseID:FBgn0034602 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_065902.1 Gene:ISLR2 / 57611 HGNCID:29286 Length:745 Species:Homo sapiens


Alignment Length:146 Identity:33/146 - (22%)
Similarity:50/146 - (34%) Gaps:46/146 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 LSKLYHPDKNKGSEVAAEKFRDITAAYEVLGNYRLRKLYDKGILHTAGRQFASEAPTAAADHTED 124
            ||:...|:...|||.:.:.....|||.|                 |.|:..||..|     :::|
Human    62 LSEEEDPEDRSGSEDSEDGVEMATAAIE-----------------TQGKLEASSVP-----NSDD 104

  Fly   125 DAQTRFYKKRMTRTHAPTATGRTPIYDF-----DEWSRN------------------HYGSRFDQ 166
            ||::........|..| ..|..|..:.|     .|||||                  .:..:..:
Human   105 DAESCPICLNAFRDQA-VGTPETCAHYFCLDCIIEWSRNANSCPVDRTVFKCICIRAQFNGKILK 168

  Fly   167 KMKAEERFKKKAEREE 182
            |:..|.....:||.|:
Human   169 KIPVENTKACEAEEED 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LapsynNP_611561.1 LRR <34..>214 CDD:443914 33/146 (23%)
leucine-rich repeat 39..59 CDD:275380
leucine-rich repeat 60..83 CDD:275380 6/22 (27%)
leucine-rich repeat 84..107 CDD:275380 4/22 (18%)
leucine-rich repeat 108..130 CDD:275380 6/21 (29%)
leucine-rich repeat 131..154 CDD:275380 5/27 (19%)
leucine-rich repeat 157..178 CDD:275380 4/38 (11%)
leucine-rich repeat 179..202 CDD:275380 2/4 (50%)
ISLR2NP_065902.1 leucine-rich repeat 36..52 CDD:275380
LRR <51..>183 CDD:443914 32/143 (22%)
LRR 1 52..73 3/10 (30%)
leucine-rich repeat 53..76 CDD:275380 5/13 (38%)
LRR 2 76..97 6/37 (16%)
leucine-rich repeat 77..100 CDD:275380 8/39 (21%)
LRR 3 100..123 6/28 (21%)
leucine-rich repeat 101..124 CDD:275380 5/23 (22%)
LRR 4 124..145 7/20 (35%)
leucine-rich repeat 125..148 CDD:275380 7/22 (32%)
LRR 5 148..169 0/20 (0%)
leucine-rich repeat 149..172 CDD:275380 1/22 (5%)
PCC 154..>228 CDD:188093 5/31 (16%)
Ig_3 232..359 CDD:464046
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 287..326
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 375..466
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 656..722
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.